KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4490Help
Entry
Bcenmc03_4490     CDS       T00669                                 

Definition
(GenBank) hypothetical protein
Organism
bcm  Burkholderia cenocepacia MC0-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3304
Motif
Other DBs
NCBI-ProteinID: ACA93630
UniProt: B1K9N7
LinkDB All DBs
Position
2:complement(1463575..1464252)
Genome map
AA seq 225 aa AA seqDB search
MNRCWITLLSVMVFSTAACSKSVNDAEKDSLAPGEVNKWNDPNYDVITAGSFNYTDYDIY
GVYLLPPDKNSLDDAASADGAHATPRSAKYWSGGGGSRPSLAWDFRWKTPKTFKVWWERV
VDKRAMEASSANYDPYTHRETQPGMAWCEGEITVTRPPVKDKSGGIVLHFFPDGRVEGDM
DFGADGPDPKVALSKRDAQRKLTDRACLKEIPNPFYGRKKPAQWN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgctgctggatcactttgctgtccgtgatggttttttccacggctgcgtgcagc
aagagcgtgaacgatgccgagaaggacagcttggcgcccggcgaagtgaacaaatggaac
gacccgaactacgacgtcatcacggccgggtccttcaactatacggattacgacatctac
ggcgtctatctgctgccgcccgacaagaacagcctcgacgacgcggcgagcgccgacggc
gcgcacgccacgccgcggagcgcgaaatactggtccggcggcggcggctcgcgcccgagt
ctcgcgtgggatttccgctggaagaccccgaagacgttcaaggtgtggtgggagcgggtg
gtcgacaaacgcgcgatggaagcgtcgtccgcgaactacgacccgtacacgcaccgggaa
acccagccggggatggcgtggtgcgaaggcgagatcacggtcacgcgcccgcccgtcaag
gacaagagcggcggtatcgtgctgcacttcttccccgatggccgcgtggaaggcgacatg
gatttcggcgccgacggcccggacccgaaggtggccctgtcgaagcgcgacgcgcagcgc
aagctgaccgaccgcgcgtgcctgaaggaaattcccaatccgttctatgggcgcaagaag
ccggcccagtggaattga

DBGET integrated database retrieval system