KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4494Help
Entry
Bcenmc03_4494     CDS       T00669                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
bcm  Burkholderia cenocepacia MC0-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: ACA93634
UniProt: B1K228
LinkDB All DBs
Position
2:complement(1469255..1470235)
Genome map
AA seq 326 aa AA seqDB search
MTNSTVFSRTRGSTADVPARDRMAYWDAFNAATLVGLRCSSLSPAGLEAEKTDIALPGLG
IADISGQDHVIERSPALVRQLPKESLFACQILSGRAYFIQHDRCLLAEAGDLVVYDTRVP
YLFGFLTPMRQLLIDIPITTFDDRLDAELAALPLRIAPKPGAGAMLGATLRASVERFMKA
PVERDAARFAEHTRTLIAELIDAEVNGAGASRASLSYLLTAKQYIATHLGEPELAPQAVA
DAVGLSLRHLGRLFAAEGESITQHIWSERLSHAHRELTDARLRKTSIGEIAFRWGFSSQA
HFSRAIRERYGASPMALRDAAREAAG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaattcgaccgttttttcacgcacgcgaggctcgacggccgacgtgccggcgcgc
gaccggatggcgtactgggatgcgttcaacgcggcgacgctggtcggcctgcgctgctcg
tcgctgtcgccggccgggctggaagccgagaagaccgatatcgcgctgccgggcctcggc
atcgccgacatcagcgggcaggatcacgtgatcgagcgcagccccgcgctggtgcgccag
ttgccgaaggagtcgctgttcgcttgccagatcctgagcgggcgcgcgtatttcatccag
cacgaccggtgcctgctcgcggaggccggcgatctcgtcgtgtacgacacccgcgtgccg
tatctattcggattcctcacgccgatgcggcagttgctgatcgatatcccgatcacgacg
ttcgacgaccgtctcgatgccgaactggccgcgctgccgctgcggatcgcgccgaagccg
ggcgcgggcgcgatgctcggcgcaacattgcgtgcgagcgtcgagcggttcatgaaggcg
ccggtggagcgcgacgccgcgcggttcgccgagcacacgcgcacgctgatcgcggaactc
atcgacgcggaagtgaacggtgcgggcgcctcgcgcgcgtcgctgtcgtacctgctgacc
gcgaagcagtacatcgcgacgcatctgggcgagccggagctcgcgccgcaggccgtcgcc
gacgcggtcgggctgtcgctgcggcatctgggccgcctcttcgcggccgaaggcgagtcg
atcacgcagcacatctggtcggaacggctgtcgcacgcgcatcgcgagctgacggatgcg
cggctgcgcaagacgagcatcggcgagatcgcgtttcgctgggggttttcgagccaggcg
catttcagccgcgcgatccgcgagcgctacggcgcgtcgccgatggcgctgcgcgatgcg
gcgcgcgaggccgcgggctga

DBGET integrated database retrieval system