KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4495Help
Entry
Bcenmc03_4495     CDS       T00669                                 

Definition
(GenBank) Cupin 2 conserved barrel domain protein
Organism
bcm  Burkholderia cenocepacia MC0-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ACA93635
UniProt: B1K229
LinkDB All DBs
Position
2:1470411..1470944
Genome map
AA seq 177 aa AA seqDB search
MVDKAVSEFWQNIPAIANPFKPDALPEAYIPNAATDDERYYVPFTETVSSRPLWISPSQN
KWCDILMAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDDAGNPDGYFDVHSYIAMCKAHYEKVGLGAQAVEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacaaagccgtatccgaattctggcaaaacattccggcgattgccaatccgttc
aagcccgatgcgctgcccgaggcctacatcccgaacgcggccaccgacgacgagcgctat
tacgttccgttcaccgaaacggtttcgtcgcggccgctgtggatctcgccgtcgcagaac
aaatggtgcgacatcctgatggcgaaggaagcggggctggtgaaccggcactatcacccg
cacgaggtgttcgcgtacacgctgtcggggaaatggggttacctcgaacacgaatggacc
gcgacgcgcggcgatttcgtgtacgagacgccgggcgagggccacacgctcgtcgcgttc
gatcacccggagccgatgcgcgcgttcttcatcgtcaagggcccgctgatctggctcgac
gacgcaggcaatcccgacggctatttcgacgtgcattcgtacatcgcgatgtgcaaggcg
cattacgagaaggtcggcctcggcgcgcaagcggtcgagaagctgttccgctga

DBGET integrated database retrieval system