KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_4497Help
Entry
Bcenmc03_4497     CDS       T00669                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcenmc03_4497
Enzymes [BR:bcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bcenmc03_4497
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bcenmc03_4497
    1.1.1.-  
     Bcenmc03_4497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc Methyltransf_25 Methyltransf_11 Methyltransf_12 DZR TrkA_N
Motif
Other DBs
NCBI-ProteinID: ACA93637
UniProt: B1K231
LinkDB All DBs
Position
2:1472269..1473390
Genome map
AA seq 373 aa AA seqDB search
MRALQWHGPRDVRLVEIDTPRVGPGDVRIAVAYCGICGSDLHEYADGPHAIPVDAPHPLS
RRTAPLTLGHEFCGTVVEVGADVTTLRAGDRVAVEPEYRCSQCAYCRSGSYNLCVSMGFA
GLMGDGGMADFAVVPAYMLHRLPDGVSLEQAAVMEPAAVALHALRRGELRLGETCAVFGL
GPIGLLLIMLAKLQGATTIVAVDVSPERLAAATRFGATHALDARTLDAAALHDAIRAATG
GLGVDTSFEAAGLQATFESAMRALRKGGRVVMVGLMPHAGFDAFRAVNDELTVTTSVGYR
HAYEDLLRIVASGALDLTSIVTRTVSLEDAVADGFDALLADRAQIKILVSPTQRPARRAS
TTGSIEHESSVGV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcacttcaatggcatggcccgcgcgacgtccgtctcgtggaaatcgacacgccg
cgcgtcggccccggcgacgtgcgcatcgcggtcgcgtattgcgggatctgcggcagcgac
ctgcacgaatacgcggacggcccgcacgcgattccagtcgatgcgccgcatccgctgtcg
cgccgcaccgcgccgctgacgctcggccacgagttctgcggcaccgtcgtcgaagtcggc
gccgacgtgacgacgctgcgcgcgggcgaccgcgtcgcggtcgaacccgagtatcgctgc
agccagtgcgcgtactgccgttcggggtcgtacaacctgtgcgtgtcgatgggcttcgcc
gggctgatgggcgacggcgggatggccgacttcgcggtcgtgccggcctacatgctgcat
cggctgcccgacggcgtgagcctcgaacaggccgcggtgatggagccggccgccgttgca
ctgcacgcgctgcggcgcggcgaactgcggctcggcgagacctgcgcggtgttcgggctc
gggccgatcggcctgctgctgatcatgctcgcgaagctgcagggcgcgaccacgatcgtc
gccgtcgacgtgtcgcccgaacggctcgcggccgccacacgcttcggtgcgacgcatgcg
ttggatgcgcgtacgctcgatgccgccgcgttgcacgacgcgattcgcgcggccacgggc
gggctcggcgtcgatacgagtttcgaggcggccggattgcaggccacgttcgaatcggcg
atgcgggcactgcgcaagggtggccgcgtcgtgatggtcggcctgatgccgcacgcgggt
ttcgacgcgttccgcgcggtcaacgacgagctgacggtcaccacgagcgtcggctaccgg
cacgcatacgaggacctgctgcgcatcgtcgcgtcgggcgcgctcgacctcacgtcgatc
gtcacgcgcaccgtgtcgctcgaggatgccgtcgccgacggcttcgacgcgctgctcgcc
gatcgcgcgcagatcaagatcctcgtttcacccacgcaacggccggcccgtcgcgcgtcc
actaccgggagcatcgagcatgagtcgtcagtgggcgtttga

DBGET integrated database retrieval system