KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6087Help
Entry
Bcenmc03_6087     CDS       T00669                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bcm  Burkholderia cenocepacia MC0-3
Pathway
bcm00500  Starch and sucrose metabolism
bcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcenmc03_6087
Enzymes [BR:bcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Bcenmc03_6087
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Bcenmc03_6087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: ACA95208
UniProt: B1KAG1
LinkDB All DBs
Position
3:complement(72466..75879)
Genome map
AA seq 1137 aa AA seqDB search
MMKREDSLDDVRRAQFPSLAPAGTPRRRRARRREPALCADDPLWYKDAIIYQVHVKSFYD
SNNDGIGDFPGLIAKLDYIAELGVDTIWLLPFYPSPRRDDGYDIADYRDVHPDYGTLADV
RRFIREAHARGIRVIAELVINHTSDQHPWFQRARRAKPGSTHRDYYVWSDTDTKYAGTRI
IFLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVIQVMRFWLDLGIDGLRLD
AVPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLAEANQWPEDVQEYFGNEDEC
HMAFHFPLMPRIYMSIASEDRFPILDIMRQTPALAPSNQWAVFLRNHDELTLEMVTDSER
DLLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGD
NIHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGSLYGYDAINVEAQTRDPHSLL
NWTRRILATRRASQAFGRGTIRFLRPENRKVLAYLRELDGHEPVLCVANLSRASQAVELD
LSEFAGRVPIEMTSDSPFPPIGQLPYLLTFPPYGFLWFVLAEHGREPSWRQPHAEPLPEY
VTLVMRRGDTRPDVSQLHALAHDALASWLARRRWFASKDRKIGDAWLNVVTPIPDEPFQY
AEAWVSASDGGVERYVVPLATAWGGETSHPLFAQLALARVRRGHTVGYLTDAFALPAFAR
GMLRKLRDGATVPTSDGGRLTFLPEDALAGLDPGDDAEVRWLAAEQSNSSLVIGDAIVLK
LVRKVAHGIHPEAEMSRHLTRIGYANTATLAGEVVHVDPDGTPHTVAILQRYVDNQGDAW
TRSFDFLRRAIDELALPAADEGEAAETDEEPDALLGYAAFAGIIGTRLGQLHVALAQPSD
DPAFAPEPATPEHVDGWCVDAIASFERALDVLGTRLDALDPATRASADALLASRDAAVEA
LGELVPRTLDAQCTRIHGDFHLGQVLDVQGDALLIDFEGEPARPLERRRAKSHPLRDVAG
LLRSLSYVSATAQFAIEKAPPQAAGRKRALFDRFGQAAADRFVECYRAAADLAPARFVDP
HYADRLLALFLIDKASYELCYEAANRPDWLSVPVGGLAALVDRLLGDGVLPDDGGNP
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacgcgaagattccctcgacgacgtgcgccgcgcgcaattcccgtcgctcgcg
ccggccggcacgccgcgccggcgccgcgcgcgccgccgcgaacccgcgctctgtgcggac
gatccgctgtggtacaaggacgcgatcatctaccaggtgcacgtgaagtcgttctacgac
tcgaacaacgacggcatcggcgatttccccggcctgatcgcgaagctcgactacatcgcc
gaactcggcgtcgacacgatctggctgctgccgttctatccgtcgccgcgccgcgacgac
ggctacgacatcgccgactaccgcgacgtgcatcccgactacggcacgctggccgacgtg
cggcgcttcatccgcgaggcgcatgcgcgcggcatccgcgtgatcgcggagctcgtgatc
aaccacacgtcggaccagcatccgtggttccagcgcgctcgccgcgcgaagccgggctcc
acgcatcgcgactactacgtgtggtccgacaccgacacgaaatacgcgggcacgcggatc
atctttctggataccgaaacgtcgaactggacccacgacccggtggccggccagtactac
tggcaccgcttctactcgcaccagccggacctgaacttcgacaacccggccgtcgtgcgc
gaagtgatccaggtgatgcgcttctggctcgacctcggcatcgacgggctgcggctcgac
gcggtgccgtatctcgtcgagcgcgaaggtaccaacaacgagaacctgcccgagacgcat
gcgatcctgaagcggattcgcgcgacgatcgacgccgagtacccgaaccggatgctgctc
gcggaagcgaaccagtggccggaagacgtgcaggaatacttcggcaacgaggacgaatgc
cacatggcgttccacttcccgctgatgccgcgcatctacatgtcgatcgcgagcgaggat
cgcttcccgatcctcgacatcatgcggcagacgccggcgctcgcgccgagcaaccagtgg
gccgtgttcctgcgcaaccacgacgagctgacgctcgagatggtcaccgattcggagcgc
gacctgctgtggcagacctatgcgagcgaccgccgcgcgcggctgaacctcggcatccgg
cgccggctcgcgccgctgatggagcgcgaccgccgacgcatcgagctgatcaattcgctg
ctgctgtcgatgcccggcacgccggtgatctactacggcgacgaactcgggatgggcgac
aacatccacctcggcgaccgcgacggcgtgcgcacgccgatgcagtggtcgtcggatcgc
aacggcggcttctcgcgcgccgaccccgaactgctggtgctgccgccggtgatgggctcg
ctgtacggctacgacgcaatcaacgtcgaggcgcagacgcgcgatccgcactcgctgctg
aactggacccgccgcatcctcgcgacgcgccgtgcgtcgcaggcgttcgggcgcggcacg
atccgcttcctgcgcccggagaaccgcaaggtgctcgcgtacctgcgcgagctggacggc
cacgagccggtgctgtgcgtcgcgaacctgtcgcgcgcgtcgcaggcggtcgaactcgac
ctgtccgaattcgcgggccgcgtgccgatcgagatgacctccgattcgccgtttccgccg
atcggccagctcccgtatctcctcaccttcccgccgtacggattcctgtggttcgtgctc
gccgagcatggccgcgagccgtcgtggcggcagccgcacgcggagccgctgcccgaatac
gtgacgctcgtgatgcggcgcggcgatacgcggccggatgtctcgcaactgcacgcgctg
gctcacgacgcgctcgcgtcgtggctcgcgcggcggcgctggttcgcatcgaaggatcgc
aagatcggcgacgcgtggctgaacgtcgtcacgccgattccggacgagccgttccagtat
gcggaggcgtgggtgtccgcgagcgacggcggcgtcgagcgctacgtggtgccgctcgcg
accgcgtggggcggcgagacgtcccatccgctgttcgcgcaactggcgctcgcgcgcgtg
cggcgcggccatacggtcggctacctgaccgatgcgttcgcgctgccggcattcgcgcgc
gggatgctgcgcaagctgcgcgacggcgcgacggtgcccacgtccgacggcggccggctc
acctttctgccggaagacgcgctcgccgggctcgatccgggcgacgacgcggaagtgcgc
tggctcgcggccgagcagagcaacagttcgctcgtgatcggcgacgcgatcgtgctgaag
ctggtgcgcaaggtcgcgcacggcattcatccggaagcggaaatgagccggcacctgacg
cgcatcggctatgcgaacaccgcgacgctggccggcgaagtcgtgcacgtcgacccggac
ggcacgccgcatacggtcgcgatcctgcagcgctacgtcgacaaccagggcgacgcgtgg
acgcgctcgttcgacttcctgcggcgcgcgatcgacgaactggcgctgcccgccgcggac
gaaggcgaggcggccgaaacggacgaggaacccgacgcgctgctcggctacgcggcgttc
gcgggcatcatcggcacgcggctcggccagttgcacgtcgcgctcgcgcagccgtccgac
gatcccgcgttcgcgccggagcccgcgacgcccgagcacgtcgacggctggtgcgtggac
gcgatcgcgtcgttcgaacgcgcgctcgacgtgctgggcacgcggctcgacgcgctcgat
ccggccacccgcgcgtcggccgacgcgctgctcgcgtcgcgcgacgcggccgtcgaggcg
ctcggcgaactggtgccacgcacgctcgacgcgcaatgcacgcggattcacggcgatttt
catctgggccaggtgctcgacgtgcagggcgacgcgctgctgatcgacttcgaaggcgaa
ccggcgcgcccgctcgagcggcgtcgcgcgaaatcgcatccgctgcgcgacgtggccggc
ctgctgcgctcgctgtcctatgtcagcgcgaccgcgcagttcgcgatcgagaaggcgccg
ccgcaagcggccggccgcaagcgtgcgctgttcgaccgcttcgggcaggccgcggccgat
cgcttcgtcgaatgctatcgcgcggcggccgacctcgcgcccgcgcgcttcgtcgatccg
cactacgcggatcgcctgctcgcgctgttcctgatcgacaaggcgtcgtacgagctgtgc
tacgaagccgcgaaccggcccgactggctgagcgtgccggtcggcgggctcgcggcgctg
gtcgaccggctgctcggcgacggcgtgctgccggacgacggaggaaatccatga

DBGET integrated database retrieval system