KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6348Help
Entry
Bcenmc03_6348     CDS       T00669                                 

Definition
(GenBank) Glyoxalase/bleomycin resistance protein/dioxygenase
Organism
bcm  Burkholderia cenocepacia MC0-3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase
Motif
Other DBs
NCBI-ProteinID: ACA95463
UniProt: B1KB66
LinkDB All DBs
Position
3:complement(362550..362957)
Genome map
AA seq 135 aa AA seqDB search
MTETTPTMKLNHLSFPSADTLATARFFERYLGFTIAGSWDKSWILKRPGFDVVIDHVGDG
VPAWPTNFHVGFELPSLDAVHALFARFKEEGVAMETDVFNNGRGSRFFCRAPGGVMFELN
TRADAAPEYQGTFDD
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaacgacacccacgatgaagctcaaccacctgagctttccctctgccgacacg
ctggcgacggcccgattcttcgagcgatacctcggcttcacgatcgcgggaagctgggac
aaatcctggattctcaagcgcccgggcttcgacgtcgtgatcgatcacgtcggcgacggc
gtgcccgcatggccgaccaatttccacgtcggcttcgaactgccgagcctcgatgccgtg
cacgcattgttcgcgcgcttcaaggaggagggcgttgcaatggagacggacgtgttcaac
aacgggcgcggctcgcgcttcttttgccgtgcgccgggcggtgtgatgttcgaattgaac
acgcgcgcggatgccgcgccggaatatcagggcactttcgacgattga

DBGET integrated database retrieval system