KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6354Help
Entry
Bcenmc03_6354     CDS       T00669                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bcm  Burkholderia cenocepacia MC0-3
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACA95469
UniProt: B1KB72
LinkDB All DBs
Position
3:complement(372863..376363)
Genome map
AA seq 1166 aa AA seqDB search
MKTKMNVKLTGIALSVAAVFSLAATASQAVVVTAVPGSLSNTDGLIIEGASPATGGLIGT
VTGWGNGVVTVGNPNAGGISIGLAGTGTGSAAIGIGSGLLEPVAGVAGTVTGALGGLGGS
GGTTGGLGGVVGTVANAATGAVGAVTGVLGGIGGSGGATGGLGGVVGTVTGALGGIGGGN
PTGGLGGVVGTVANTATGAVGTLTGALGGVGGGTGGLGGIVGTVGNAASGAVGTVTGALG
GVGGGGTGGLGGVVGTVTGALGGIGGGTGGLGGVVGTVANTATGAVGTLTGALGGVGGGA
GGLGGVVGAVGNAASGAVGTVTGALGGVGGGGTGGLGGVIGTVTGALGGIGGGTGGLGGV
VGTVANTATGAVGTLTGALGGVGGGTGGLGGVVGAVGNAASGAVGTVTGALGGVGGGGTG
GLGGVVGTVTGALGGIGGGNPTGGLGGVVGTVANTATGAVGTLTGALGGVGGGTGGLGGV
VGTVGNAASGAVGTVTGALGGVGDPTGGLGGVVGTVTGALGGIGGGTGGLGGVVGTVGNA
ASGAVGTVTGALGGVGGGGTGGLGGVVGTVTGALGGIGGGNPTGGLGGVVGTVANTATGA
VGTLTGALGGVGGGTGGLGGVVGTVANTATGAVGTVTGALGGGGGGTGGLGGVVGTVANT
ATGAVGTLTGALGGVGGGTGGLGGVVSTAANTATGAVGTLTGALGGVGGGTGGLGGIVGT
VANTATGAVGTLTGALGGVGGGTGGLGGIVGTVANTATGAVGTLTGALGGVGGGTGGLGG
VVSTVANTATGAVGTLTGTLGGVGGATGGLGSIVGTVANTATGAVGTLTGALGGVGGGTG
GLGGVVGTVANTATGAVGTLTGALGDIGGGTGGLGGVVSTVANTATGAVGTLTGALGGVG
GGTGSLGGVVGTVANTATGAVGTLTGTLGGVGGATGGLGNIVGTVANTGTGVVNAVTGVA
GNGGALITPITSIVGNLGGSLPVGAATGAIGAVSGAVTGVAGSGTAAITPLASAVTSLIG
SATSGAGGIAGAGTGVLTGATGAAGSLAAVTTGLTGTLANTVTGTTGAIAGTLPALSVAL
NGGTAAGAVGGATNAVGALVSGGATIANAAVHSVGSAVGSVAGVLPALAVSLNSDSAQGG
SAGAGGGLLAPVTSLVSSLTAPLPRK
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaaaatgaacgtgaaattgacgggcatcgccctgtcggtcgcggctgtcttc
agcctggccgccacggcgtcccaggcggtggtcgtgactgccgtgccgggaagtctcagc
aacaccgacggcttgatcatcgaaggcgcgtcgccggcgaccggaggactcatcggcacg
gtgacgggatgggggaatggggtggtgacggtcggcaacccgaatgcaggcggtatctcg
atcgggctggccgggacggggacgggaagcgcggccattggtatcggtagcggattgctc
gagccggtcgcgggcgtggccggtacggtgacgggtgcgctgggtggtctcggcggaagt
ggtggtacgaccggcgggcttggtggtgtcgtcgggacggtggcgaacgcggccactggc
gcggtcggtgccgtgacgggcgtgttgggtggcattggtggcagcggcggtgcgaccggt
ggtctcggtggcgtcgttggcacggtgaccggtgcgctgggtggcatcggtgggggcaat
ccgactggcggtctcggtggcgtcgtcggcacggtggcgaacacggcaaccggcgcagtc
gggacgctgacgggagcgctgggcggtgttggcggtgggaccggcggtctcggcggcatt
gtcgggacggtgggcaacgcggcaagcggcgcagtcggcacggtaacgggtgcattgggc
ggtgtcggcggtggcgggaccggtggtcttggtggcgtggtcggcacggtaaccggtgcg
ctgggtggtatcggtggcgggactggtggcctcggcggtgtcgtcggcacggtggcgaac
acggcaacgggcgcagtcggaacgttgactggcgcgctgggcggtgttggaggcggggcc
ggtggtctcggcggcgtggtgggagcggtcggcaacgcggcaagcggcgcagtcggtacg
gtgacgggtgcgttgggcggtgtcggcggtggtggcactggtggtcttggtggcgtgatt
ggtacggtaactggtgcgctgggtggtatcggtggcgggactggtggcctcggcggtgtt
gtcggcacggtggcgaacacggcgacgggcgcagtcgggacgttgactggcgcactgggc
ggtgttggaggtgggaccggcggtctcggcggtgtcgtgggagcggtcggcaacgcggca
agcggcgcagtcggcacggtgacgggtgcgttgggcggtgtcggcggtggtgggactggt
ggtcttggtggcgtggttggcacggtaactggtgcgctgggtggcatcggtggtggcaat
ccgactggcggcctcggtggcgtcgtcgggacggtagcaaacacggcgacgggcgcagtc
ggaacgctgaccggggcactgggcggtgttggaggtgggaccggcggtctcggtggcgtc
gtcgggacagtgggcaacgcggcaagcggagcagtcggtacggtgacgggggcattgggc
ggtgttggcgatccgaccggcgggcttggtggtgtggtcggtacggtaaccggcgcactg
ggtggcatcggaggcgggaccggcggtctcggtggtgttgtcgggacagtgggcaacgcg
gcaagcggcgcagtcggcacggtgacgggtgcgttgggcggtgtcggcggtggtgggact
ggtggtcttggtggcgtggttggcacggtaactggtgcgctgggtggcatcggtggtggc
aatccgactggcggcctcggtggcgtcgtcgggacggtagcaaacacggcgacgggcgca
gtcggaacgctgaccggggcactggggggtgttggcggcgggactggtggtctcggcggt
gtcgtcggcacggtagcgaacacggcaacgggcgcagtcggtacggtaaccggcgcactg
ggggggggtggcggcgggactggtggtctcggcggtgtcgtcggcacggtggcgaacacg
gccacgggcgcagtcggaacgctgaccggcgcactgggtggtgttggaggcgggaccggt
ggtcttggcggcgtcgtcagcacggcagcgaacacggcaacgggcgcagtcggaacgctg
accggcgcactgggtggcgtcggaggcgggaccggcggcctcggcggcatcgtcggcacg
gtagcgaacacggcaaccggcgcagtcggaacgctgaccggcgcactgggtggcgtcgga
ggcgggaccggcggcctcggcggcatcgtcggcacggtagcgaacacggcaaccggcgca
gtcggaacgctgaccggcgcactgggtggtgttggaggtgggaccggcggcctcggcggc
gtcgtcagcacggtagcaaacacggcaacgggcgcagtcggaacactgactggcacactg
ggcggtgtcggtggcgcgaccggcggtctcggcagcatcgtcggcacggtggcgaacacg
gcgacgggcgcagtcgggacgctgacgggcgcactgggtggtgttggaggcgggaccggt
ggcctcggcggcgttgtcggcacggtggcgaacacggcgaccggcgcagtcggaacgctg
accggcgcactgggcgacatcggcggcgggaccggcggtctcggcggtgtcgtcagcacg
gtagcaaacacggccacgggcgcagtcggaacgctgaccggcgcactgggtggcgtcgga
ggcggcaccggcagtctcggcggcgtcgtcggcacggtagccaacacggccacgggcgca
gtcggaacactgactggcacactgggcggtgtcggaggcgcgaccggcggtctcggcaac
atcgtcggcacggtagccaacaccggcacgggtgtcgtcaacgccgtcaccggtgtcgcg
ggcaacggcggcgcgctgatcacgccgatcacgagcatcgtcggcaatctcggcggatcg
ctgcctgtcggtgccgccaccggcgcgatcggcgcagtgtccggcgcggtaaccggcgtc
gccggcagcggcacggcggcgatcacgccgctcgcatcggcggtcacgtcattgatcgga
tcggccacgagcggcgcaggcggcatcgccggcgccggaaccggcgttctcacgggcgca
accggggcggccggctccctcgcggcggtcacgaccggcctgacgggtacgctggcgaac
accgtaaccggcacgacgggcgcgatcgcaggcacgctgccggcactgagtgtcgcgctc
aacggtggcacggcggctggtgcggtcggcggcgcgaccaatgcagtcggcgcgctcgtc
tccggcggcgcgacgatcgccaacgcggcggtgcattcggtcgggtcggctgtcggatcg
gtggccggcgtgctcccggcgctggcggtttcgctgaacagcgattccgcgcaagggggc
agtgccggggcaggcggcggtctgctggcgccggtgacgtcgctcgtcagttcgctgacc
gcgccgctgccgaggaagtaa

DBGET integrated database retrieval system