KEGG   Burkholderia cenocepacia MC0-3: Bcenmc03_6459Help
Entry
Bcenmc03_6459     CDS       T00669                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bcm  Burkholderia cenocepacia MC0-3
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACA95574
UniProt: B1KBH7
LinkDB All DBs
Position
3:499930..500139
Genome map
AA seq 69 aa AA seqDB search
MIIDELLGLIRRHEVTRIDTVVPARIADSAMCHQPELHMFMAVRALSIGAGYSEFESDEI
ASAVMTRLG
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgacgaactgctcggcttgatcagacgacatgaagtcacccggatcgacacc
gtcgtacccgccagaatcgccgattcagcgatgtgccatcaaccggaactgcacatgttc
atggcggtacgtgcgctatcgatcggagcaggatattcggaattcgaatccgacgagata
gcaagcgccgtcatgacgcggctcggctag

DBGET integrated database retrieval system