KEGG   Burkholderia cenocepacia AU1054: Bcen_0078Help
Entry
Bcen_0078         CDS       T00363                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00471  D-Glutamine and D-glutamate metabolism
bcn00550  Peptidoglycan biosynthesis
bcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Bcen_0078
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bcen_0078
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcn01011]
    Bcen_0078
Enzymes [BR:bcn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     Bcen_0078
Peptidoglycan biosynthesis and degradation proteins [BR:bcn01011]
 Precursor biosynthesis
  Amino acid ligase
   Bcen_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C DELLA
Motif
Other DBs
NCBI-ProteinID: ABF74993
UniProt: Q1BZG2
LinkDB All DBs
Position
1:81279..82676
Genome map
AA seq 465 aa AA seqDB search
MKHIVKHIHFVGIGGAGMSGIAEVLVNLGYAVSGSDLSRNAVTDRLEALGARIAIGHDAA
NIEGANAVVVSTAVRSDNPEVLAARHQGVPIVQRAVMLAELMRLKQGIAIAGTHGKTTTT
SLVASVLAAGGLDPTFVIGGRLISAGANARLGTGDFIVAEADESDASFLNLYPVIEVITN
IDADHMDTYGHDFARLKQAFIEFTQRLPFYGSAVVCVDDPNVRQIIPFISKPVVRYGLSP
DAQVRAEDIDARDGRMHFTVIREGRAPLAVVLNMPGLHNVQNALAAIAIATDLGVSDDAI
QLALAEFNGVGRRFQRYGEVPSADGGQYTLIDDYGHHPVEMAATIAAARGAFPGRRLVLA
FQPHRYTRTRDCFDDFVNVLSTVDALVLTEVYAAGEAAIPTASGDALSRALRAVGKVDPV
FVATVDDVPDALAKVAQNGDVVITMGAGSIGGVPAKLVQHIQQKA
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacatcgtcaaacacattcatttcgtcgggatcggcggcgcgggcatgagcggc
atcgccgaagtgctcgtcaacctcggctacgcggtcagcggctcggacctgtcgcgcaat
gcggtgaccgatcgcctcgaggcgctaggcgcgcggatcgcgatcggccacgacgcggcg
aacatcgagggcgcgaacgcggtcgtcgtgtcgacggccgtgcgctcggacaacccggaa
gtgctggccgcgcgccaccagggcgtgccgatcgtgcagcgcgcggtgatgctggcggag
ctgatgcgcctgaagcagggcatcgcgatcgccggcacgcacggcaagaccacgacgacg
agcctcgtcgcgagcgtgctcgccgcgggcgggctggacccgaccttcgtgatcggcggc
cggctgatcagcgccggcgcgaacgcgcggctcggcacgggcgacttcatcgtcgccgag
gccgacgagtcggatgcgtcgttcctgaacctgtacccggtgatcgaagtcatcacgaac
atcgacgccgaccacatggacacctacggccacgatttcgcgcggctcaagcaggcgttc
atcgaattcacgcagcgcctgccgttctacggcagcgcggtggtgtgcgtcgacgatccg
aacgtgcggcagatcattccgttcatctcgaagccggtcgtgcgctacggcctgtcgccg
gacgcgcaggtgcgcgcggaagacatcgacgcgcgcgacggccggatgcacttcacggtg
atccgcgaagggcgtgcgccgctcgcggtcgtgctgaacatgccgggcctgcacaacgtg
cagaacgcgctcgcggcgatcgcgatcgcaaccgatctcggcgtgtcggacgacgcgatc
cagctggcgctggcggaattcaacggcgtcggccggcgcttccagcgctacggcgaggtg
ccgagcgcggacggcggccagtacacgctgatcgacgactacggtcatcacccggtcgag
atggcggcgacgatcgcggccgcgcgcggcgcgttcccgggccgtcgcctcgtgctggcg
ttccagccgcaccgctacacgcgcacgcgcgactgcttcgacgatttcgtcaacgtgctg
tcgacggtcgatgcgctggtgctgacggaagtctatgcggccggcgaggccgcgatcccg
acggccagcggcgacgcgctgtcgcgtgcgctgcgcgcggtgggcaaggtcgacccggtg
ttcgtcgcgacggtcgacgacgtgccggacgcattggcgaaggtcgcgcagaacggcgac
gtggtgatcacgatgggggcgggttcgatcggcggcgtgccggcgaagctcgtgcaacac
attcaacagaaggcatga

DBGET integrated database retrieval system