KEGG   Burkholderia cenocepacia AU1054: Bcen_1323Help
Entry
Bcen_1323         CDS       T00363                                 

Definition
(GenBank) succinate dehydrogenase subunit B
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00020  Citrate cycle (TCA cycle)
bcn00190  Oxidative phosphorylation
bcn00650  Butanoate metabolism
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01200  Carbon metabolism
Module
bcn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bcn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcen_1323
   00650 Butanoate metabolism
    Bcen_1323
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bcen_1323
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Bcen_1323
    1.3.5.4  fumarate reductase (quinol)
     Bcen_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ABF76229
UniProt: A0A0H2XP56
LinkDB All DBs
Position
1:complement(1455534..1456241)
Genome map
AA seq 235 aa AA seqDB search
MSDPRTLHIYRYDPDRDAAPYMQRYEIDVNPDDRMLLDVLGRVKCDDETLSYRRSCREGI
CGSDAMNINGKNGLACLTNMQTLPREIVLRPLPGLPVVRDLIVDMTDFFNQYHSIRPYLI
NDTTPPARERLQSPEERDQLDGLYECILCACCSTSCPSYWWNPDKFVGPAGLLQAYRFIA
DSRDLATAERLDDLEDPYRLFRCRTIMNCTDVCPKGLNPTKAISEIRTMLVRRTV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccgcgcaccttgcatatctatcgctacgaccccgaccgcgacgcggcgcct
tacatgcagcgctacgagatcgacgtgaatccggacgaccgcatgctgctcgacgtgctg
ggccgcgtgaagtgcgacgacgagacgctgtcgtatcggcgctcctgccgcgaaggcatc
tgcggctcggacgcgatgaacatcaacggcaagaacggcctcgcatgcctgaccaacatg
cagacgctgccgcgcgaaatcgtgctgcggccattgccggggctgccggtggtgcgcgac
ctgatcgtcgacatgaccgatttcttcaaccagtaccactcgatccggccatacctgatc
aacgacacgacgccgcccgcgcgcgagcggctgcaatcgccggaggagcgcgaccagctc
gacgggctgtacgaatgcatcctgtgcgcgtgctgttcgacgtcgtgcccgagctactgg
tggaacccggacaagttcgtcggtcccgccgggctgctgcaggcgtatcgcttcatcgcc
gattcgcgcgatctcgcgacggccgagcggctcgacgatctcgaggacccgtaccggctg
ttccgctgccggacgatcatgaattgcacggacgtgtgcccgaaggggctgaatccgacc
aaggcgatttcggagatccggacgatgctggtcaggcggacggtgtga

DBGET integrated database retrieval system