KEGG   Burkholderia cenocepacia AU1054: Bcen_1331Help
Entry
Bcen_1331         CDS       T00363                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00500  Starch and sucrose metabolism
bcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bcen_1331
Enzymes [BR:bcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Bcen_1331
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Bcen_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: ABF76237
UniProt: A0A0H2XQG6
LinkDB All DBs
Position
1:1464810..1468223
Genome map
AA seq 1137 aa AA seqDB search
MMKREDSLDDVRRAQFPSLAPAGTPRRRRARRREPALCADDPLWYKDAIIYQVHVKSFYD
SNNDGIGDFPGLIAKLDYIAELGVDTIWLLPFYPSPRRDDGYDIADYRDVHPDYGTLADV
RRFIREAHARGIRVIAELVINHTSDQHPWFQRARRAKPGSTHRDYYVWSDTDTKYAGTRI
IFLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVIQVMRFWLDLGIDGLRLD
AVPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLAEANQWPEDVQEYFGNEDEC
HMAFHFPLMPRIYMSIASEDRFPILDIMRQTPALAPSNQWAVFLRNHDELTLEMVTDSER
DLLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGD
NIHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGSLYGYDAINVEAQTRDPHSLL
NWTRRILATRRASQAFGRGTIRFLRPENRKVLAYLRELDGHEPVLCVANLSRASQAVELD
LSEFAGRVPIEMTSDSPFPPIGQLPYLLTFPPYGFLWFVLAEHGREPSWRQPHAEPLPEY
VTLVMRRGDTRPDVSQLHALAHDALASWLARRRWFASKDRKIGDAWLNVVTPIPDEPFQY
AEAWVSASDGGVERYVVPLATAWGGETSHPLFAQLALARVRRGHTVGYLTDAFALPAFAR
GMLRKLRDGATVPTSDGGRLTFLPEDALAGLDPGDDAEVRWLAAEQSNSSLVIGDAIVLK
LVRKVAHGIHPEAEMSRHLTRIGYANTATLVGEVVHVDPDGTPHTVAILQRYVDNQGDAW
TRSFDFLRRAIDELALPAADEGEAAETDEEPDALLGYAAFAGIIGTRLGQLHVALAQPSD
DPAFAPERATPDHVDGWCVDAIASFERALDVLRTRLDALDAPTRASADALLASRDAAVEA
LGELVPRTLDAQCTRIHGDFHLGQVLDVQGDALLIDFEGEPARPLERRRAKSHPLRDVAG
LLRSLSYVSATAQFAIEKAPPQAAGRKRALFDRFGQAAADRFVECYRAAADLAPARFVDP
HYADRLLALFLIDKASYELCYEAANRPDWLSVPVGGLAALVDRLLGDGALPDDGGNP
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacgcgaagattccctcgacgacgtgcgccgcgcgcaattcccgtcgctcgcg
ccggccggcacgccgcgccggcgccgcgcgcgccgccgcgaacccgcgctctgcgcggac
gatccgctgtggtacaaggacgcgatcatctaccaggtgcacgtgaagtcgttctacgac
tcgaacaacgacggcatcggcgatttccccggcctgatcgcgaagctcgactacatcgcc
gaactcggtgtcgacacgatctggctgctgccgttctatccgtcgccgcgccgcgacgac
ggctacgacatcgccgattaccgcgacgtgcatcccgactacggcacgctggccgacgtg
cggcgcttcatccgcgaggcgcatgcgcgcggcatccgcgtgatcgcggagctcgtgatc
aaccacacgtcggaccagcatccgtggttccagcgcgcgcgccgcgcgaagccgggctcc
acgcatcgcgactactacgtgtggtccgacaccgacacgaaatacgcgggcacgcggatc
atctttctggataccgaaacgtcgaactggacccacgacccggtggccggccagtactac
tggcaccgcttctactcgcaccagccggacctgaacttcgacaacccggccgtcgtgcgc
gaagtgatccaggtgatgcgcttctggctcgacctcggcatcgacgggctgcggctcgac
gcggtgccgtatctcgtcgagcgcgaaggtaccaacaacgagaacctgcccgagacgcat
gcgatcctgaagcggattcgcgcgacgatcgacgccgagtacccgaaccggatgctgctc
gcggaagcgaaccagtggccggaagacgtgcaggaatacttcggcaacgaggacgaatgc
cacatggcgttccacttcccgctgatgccgcgcatctacatgtcgatcgcgagcgaggat
cgcttcccgatcctcgacatcatgcggcagacgccggcgctcgcgccgagcaaccagtgg
gccgtgttcctgcgcaaccacgacgagctgacgctcgagatggtcaccgattcggagcgc
gacctgctgtggcagacctatgcgagcgaccgccgcgcgcggctgaacctcggcatccgg
cgccggctcgcgccgctgatggagcgcgaccggcgccgcatcgagctgatcaattcgctg
ctgctgtcgatgcccggcacgccggtgatctactacggcgacgaactcgggatgggcgac
aacatccacctcggcgaccgcgacggcgtgcgcacgccgatgcagtggtcgtcggaccgc
aacggcggcttctcgcgcgccgaccccgaactgctggtgctgccgccggtgatgggctcg
ctgtacggctatgacgcgatcaacgtcgaggcgcagacgcgcgatccgcactcgctgctg
aactggacccgccgcatcctcgcgacgcgccgcgcgtcgcaggcgttcgggcgcggcacg
atccgcttcctgcgcccggagaaccgcaaggtgctcgcgtacctgcgcgagctggacggc
cacgagccggtgctgtgcgtcgcgaacctgtcgcgcgcgtcgcaggcggtcgaactcgac
ctgtccgaattcgcgggccgtgtgccgatcgagatgacgtccgattcgccgtttccgccg
atcggccagctcccgtatctcctcaccttcccgccgtacgggttcctgtggttcgtgctc
gccgagcatggccgcgagccgtcgtggcggcagccgcatgcggagccactgcccgaatac
gtgacgctcgtgatgcggcgcggcgatacgcggccagacgtctcgcaactgcacgcgctg
gcgcacgacgcgctcgcgtcgtggctcgcacggcggcgctggttcgcatcgaaggatcgc
aagatcggcgacgcgtggctgaacgtcgtcacgccgattccggacgagccgttccagtat
gcggaggcgtgggtgtccgcgagcgacggcggcgtcgagcgctacgtggtgccgctcgcg
accgcgtggggcggcgagacgtcccatccgctattcgcgcaactggcgctggcgcgcgtg
cggcgcggccatacggtcggctacctgaccgatgcgttcgcgctgccggcgttcgcgcgc
gggatgctgcgcaagctgcgcgacggcgcgacggtgcccacgtccgacggcggccggctc
acctttctcccggaagacgcgctcgccgggctcgatccgggcgacgacgcggaagtgcgc
tggctcgcggccgagcagagcaacagttcgctcgtgatcggcgacgcgatcgtgctgaag
ctggtgcgcaaggtcgcgcacggcattcatccggaagcggaaatgagccggcacctgacg
cgcatcggctatgcgaacactgcgacgctggtcggcgaagtcgtgcacgtcgacccggac
ggcacgccgcatacggtcgcgatcctgcagcgctacgtcgacaaccagggcgacgcgtgg
acgcgctcgttcgacttcctgcgccgcgcgatcgacgagctggcgctgccggccgcggac
gaaggcgaggcggccgaaacggacgaggaacccgacgcactgctcggctacgcggcgttc
gccggcatcatcggcacgcggctcggccagttgcacgtcgcgctcgcgcagccgtccgac
gatcccgcgttcgcaccggagcgcgcgacgcccgatcacgtcgacggctggtgcgtggac
gcgatcgcgtcgttcgaacgcgcgctcgacgtgctgcgcacgcggctcgacgcgctcgat
gcgcccacccgcgcgtcggccgacgcgctcctcgcatcgcgcgacgcggccgtcgaggcg
ctcggcgaactggtgccgcgcacgctcgacgcgcaatgcacgcggattcacggcgatttt
catctgggccaggtgctcgacgtgcagggcgacgcgctgctgatcgacttcgaaggcgaa
ccggcgcgcccgctcgagcggcgtcgcgcgaaatcgcatccgctgcgtgacgtggccggc
ctgctgcgctcgctgtcgtacgtgagcgcgaccgcgcagttcgcaatcgagaaggcgccg
ccgcaagcggccggccgcaagcgtgcgctgttcgaccgcttcggacaggccgccgccgac
cgcttcgtcgaatgctatcgcgcggcggccgacctcgcgcccgcgcgcttcgtcgatccg
cactatgcggaccgcctgctcgcgctgttcctgatcgacaaggcgtcgtacgagctgtgc
tacgaagccgcgaaccggcccgactggctgagcgtgccggtcggcgggctcgcggcgctg
gtcgaccggctgctcggcgacggcgcgctgcccgacgacggaggaaacccatga

DBGET integrated database retrieval system