KEGG   Burkholderia cenocepacia AU1054: Bcen_2561Help
Entry
Bcen_2561         CDS       T00363                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00071  Fatty acid degradation
bcn00280  Valine, leucine and isoleucine degradation
bcn00281  Geraniol degradation
bcn00310  Lysine degradation
bcn00360  Phenylalanine metabolism
bcn00362  Benzoate degradation
bcn00380  Tryptophan metabolism
bcn00410  beta-Alanine metabolism
bcn00627  Aminobenzoate degradation
bcn00640  Propanoate metabolism
bcn00650  Butanoate metabolism
bcn00903  Limonene and pinene degradation
bcn00930  Caprolactam degradation
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01212  Fatty acid metabolism
Module
bcn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcen_2561
   00650 Butanoate metabolism
    Bcen_2561
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcen_2561
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcen_2561
   00310 Lysine degradation
    Bcen_2561
   00360 Phenylalanine metabolism
    Bcen_2561
   00380 Tryptophan metabolism
    Bcen_2561
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcen_2561
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bcen_2561
   00281 Geraniol degradation
    Bcen_2561
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcen_2561
   00627 Aminobenzoate degradation
    Bcen_2561
   00930 Caprolactam degradation
    Bcen_2561
Enzymes [BR:bcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bcen_2561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABF77460
UniProt: A0A0H2XTK1
LinkDB All DBs
Position
1:complement(2817967..2818743)
Genome map
AA seq 258 aa AA seqDB search
MAYENIQVETRGRVGLVTLNRPKALNALNDALMDELGAALKAFDADDDIGAIVVTGSEKA
FAAGADIGMMATYSYMDVYRGDYITHNWETVREIRKPIIAAVSGFALGGGCELAMMCDII
FAADTAKFGQPEIKLGVMPGAGGTQRLPRAVSKAKAMDMCLTARFMDAAEAERAGLVSRV
LPADKVLEEAIAAATTIAEFSLPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQ
KEGMAAFVEKRKPVFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagaacatccaggtggagacccgggggcgtgtcggtctggtgacgctgaac
cgtccgaaggcgctgaatgcgctgaacgatgcgctgatggatgagttgggcgcggcactg
aaggcgttcgatgcggacgacgatatcggtgcgatcgtcgtgaccgggagcgagaaggcg
ttcgcggccggcgcggacatcggcatgatggcgacctactcctatatggatgtttatcgg
ggcgactacatcacgcacaactgggagacggtccgcgagatccgcaaaccgatcattgcc
gcagtttcgggctttgcgctgggcggcggctgcgaactcgcgatgatgtgcgacatcatc
ttcgcggcggacacggccaagttcggtcaaccggaaatcaagctgggcgtcatgccgggt
gcgggcggcacgcagcgtctgccgcgcgcggtatcgaaggcgaaggcgatggacatgtgc
ctgaccgcgcgcttcatggacgccgccgaggccgagcgtgccgggctcgtttcgcgcgtg
ctgccggccgacaaggtgctcgaggaggcgatcgccgccgcgacgacgatcgccgagttt
tcgctgccggcggtcatgatggtcaaggagtcggtgaaccgcgcgtacgagacgacgctg
gctgaaggcgttcacttcgagcgccggctgttccattcgctgttcgcaaccgaagaccag
aaggaagggatggcggcattcgtcgagaagcggaagccggtgttcaagcatcgctga

DBGET integrated database retrieval system