KEGG   Burkholderia cenocepacia AU1054: Bcen_2715Help
Entry
Bcen_2715         CDS       T00363                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01130  Biosynthesis of antibiotics
bcn01230  Biosynthesis of amino acids
Module
bcn_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcen_2715
Enzymes [BR:bcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Bcen_2715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 FtsK_gamma AAA_33 Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: ABF77613
UniProt: A0A0H2XSI1
LinkDB All DBs
Position
1:complement(2987860..2988369)
Genome map
AA seq 169 aa AA seqDB search
MGAGKTTVGRAVARRLDRTFFDSDHEIEARTGARIPVIFELEGEAGFRDRETQVIAELAQ
RENIVLATGGGAVLRPENRDSLKTNGIVVYLRANPHDLWLRTRKDKNRPLLQTEDPKGRL
EALYEVRDPLYRECADFVIETGRPSVNGLVNMVLMQLELAGVIAKPLQA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgggtaagaccaccgtgggccgtgcggtcgcgcgtcgtctcgacaggacgttc
ttcgactccgaccacgaaatcgaggcccgcacgggcgcgcgcattccggtgatcttcgag
ctggagggcgaggccgggtttcgcgatcgcgaaacgcaggtgatcgccgagctcgcgcag
cgcgagaacatcgtgctcgcgacgggcggcggcgcggtgctgcgcccggaaaatcgcgac
agcctgaaaaccaacggcatcgtcgtctatctgcgcgccaatccgcacgatctgtggctg
cgcacgcgcaaggacaagaaccgcccgctgttgcagacggaagatccgaaggggcgtctc
gaagcgctgtacgaagtgcgcgacccgctgtaccgcgaatgcgcggatttcgtcatcgag
actggccgtccgtcggtcaacggtctcgtcaacatggtgctgatgcaactcgaactggcc
ggcgtcatcgccaagccgctacaagcatga

DBGET integrated database retrieval system