KEGG   Burkholderia cenocepacia AU1054: Bcen_3005Help
Entry
Bcen_3005         CDS       T00363                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00250  Alanine, aspartate and glutamate metabolism
bcn00410  beta-Alanine metabolism
bcn00640  Propanoate metabolism
bcn00650  Butanoate metabolism
bcn01100  Metabolic pathways
bcn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcen_3005
   00650 Butanoate metabolism
    Bcen_3005
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcen_3005
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcen_3005
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcn01007]
    Bcen_3005
Enzymes [BR:bcn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Bcen_3005
Amino acid related enzymes [BR:bcn01007]
 Aminotransferase (transaminase)
  Class III
   Bcen_3005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABF77901
UniProt: A0A0H2XT81
LinkDB All DBs
Position
2:complement(21861..23150)
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAIADQLNNFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEF
LKPGSGEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtc
ggcgtgatgtgcgatttctacgccgcccgcgccgagaacgcggagctgtgggatgtcgaa
ggccgccgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgtcac
ccgaagatcgtcaaggcgatcgccgatcagctgaacaacttcacgcacaccgcttaccag
atcgtcccgtacgcgtcgtacgtcgaactggcggaaaagatcaacgagcgcgcgccgggc
gacttcccgaagaagacggcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatc
aagatcgcgcgcgcggcaaccggccgtccgggcgtcatcgcattctcgggcggcttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgaacttc
ggcccgttcccgggcgacgtgttccacgcgccgtacccgaacgccgtgcacggcgtgacg
accgccgactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgc
gtcgccgcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggcc
gaattcgtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgac
gaagtgcagacgggcttcgcgcgcaccggcaagctgttcgcgatgcagcactacgacgtg
ctggccgacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtc
gtcggccgggcggacgtgatggacgcggccgcccccggcggcctcggcggcacctacgcg
ggcaacccgctggcagtcgcctcggcgcacgcggtgctcgagatcatcgacgaagagaag
ctgtgcgagcgtgcgacgcaactcggcgacgtgctgaaggcgaagctgaatgcgctgcag
gccgacgtgccgcagatcgccgacgtgcgcggccccggcgcgatgatcgcggtcgaattc
ctgaagccgggttcgggcgagccggatgccgaattcacgaagcgcgtgcagacgcgtgcg
ctcgagcgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgatcccgcaagccgtgttcgacgaagcgctggtgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system