KEGG   Burkholderia cenocepacia AU1054: Bcen_4245Help
Entry
Bcen_4245         CDS       T00363                                 

Definition
(GenBank) 2,3-dimethylmalate lyase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00440  Phosphonate and phosphinate metabolism
bcn01100  Metabolic pathways
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bcen_4245
Enzymes [BR:bcn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bcen_4245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ABF79131
UniProt: A0A0H2XVW9
LinkDB All DBs
Position
2:1451295..1452980
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAETGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVATSTPHGRWIGLLNVR
GAGVDRLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGTGNGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcacgcagcgcgcgcctgcgccgcatgctc
gtcagcagcgatctcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaggccggcttcaagggtatctgggcgtcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaagtcgtcgacgtgctcgaattcatggct
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgaacagcgcggcatcgcgggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagaccgatcccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaatcatctgatccgcgcgtcggcatccgcgatgcaggcgaccgcgcgcgag
atccacgagagcgaaacgctgatcaacgtcgaggaccgcgtggcatcggtcaacgagatc
ttccgcctgcaggacgccgacgagtactcggccgccgagcgtatctacctgtcgtcgtcg
tcgcgcgcgtcgaatgccgcgatcgtgctcgccgcgagccgcggcaagggcctcgaagcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcatggcgtaaacgacatcaccgtggtcggcggctatcgc
gccgatgcgatcgatacgtcgggcatcaagctcgtcgtcaacgagcgccacgcggaaacg
ggcgagctcgcgtcgctcgcctgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgatctgctgttccgcagctacatcgtgcgcgacctcgcggagagcgaggccgag
ttcagcgtggtggtcgattcgtcgctcaccgagaccaaccagagcgtgcgcgacttcgcc
ctctgctcggcggccgacgatcgcggcctgttcggccagaagacctacctgcaacgtgtg
tcgagcgacgtcgccacgagcacgccgcacggccgctggatcggcctgctgaacgtgcgc
ggcgcgggcgtcgatcgcctgaaggcgatgctcgcgacgctgcaggcgcgccctgatttc
gacacgctcgacattccgtcgctgctgaacgaactgatcgccgccggcgagaagatcgag
gtgcagtacgtgcacggccactggcgcggcgtcaacgacctggaagacttccgccgcgcg
ggcgacttcgcgcacggccagacgccgctgtccgaaccgggcaccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system