KEGG   Burkholderia cenocepacia AU1054: Bcen_4421Help
Entry
Bcen_4421         CDS       T00363                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcen_4421
Enzymes [BR:bcn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bcen_4421
Transporters [BR:bcn02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcen_4421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABF79303
UniProt: A0A0H2XYJ3
LinkDB All DBs
Position
2:1654981..1655706
Genome map
AA seq 241 aa AA seqDB search
MQYELYYWPEIQGRGEYVRLALEAAEADYVDVARESGRGMGVSAMMRMMDSAKAECVPFA
PPFLKAGDVVVGQTANILLFLGARLGLAPDDEAGRLWVHQIQLTAADFVTEIHDTHHPIG
SGLYYEEQQAEAAERAADFLENRLPKFLGYFDRLLEQNPHKSGYIAGSALTYADLTMFQL
IEGLRYAFPKAMKRAERKVAALVALHDRVAQHPPVARYLESERRIPFNDMGIFRHYPELD
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacgaactctattactggcccgagatccagggccgcggcgaatacgtgcggctc
gcgctcgaggcggccgaggccgattacgtcgacgtcgcgcgcgaatcggggcgcggaatg
ggcgtgtcggccatgatgcgcatgatggacagcgcgaaggccgaatgcgtgccgttcgcg
ccgccgttcctgaaggccggcgacgtggtcgtcgggcagaccgcgaacatcctgctgttt
ctcggcgcgcggctcgggctcgcgcctgacgacgaagccggccggctgtgggtgcaccag
atccagctgaccgccgccgatttcgtcaccgagatccacgacacccaccatccgatcggc
agcggcctctactacgaggagcagcaagcggaagcagccgagcgcgccgccgatttcctc
gagaaccggctgccgaaattcctcggctacttcgatcgcctgctcgaacagaatccccac
aagagcggctatatcgccggcagcgcgctcacctatgcggacctgacgatgttccagttg
atcgagggcctgcgctacgcgttcccgaaagcgatgaagcgcgcggagcgcaaggtcgcg
gcgctggtcgcgctgcacgatcgcgtcgcgcagcatccgccggtcgcgcgctacctcgag
tcggaacgccgcatcccgttcaacgacatggggatcttccggcactatccggagctggac
aagtaa

DBGET integrated database retrieval system