KEGG   Burkholderia cenocepacia AU1054: Bcen_5127Help
Entry
Bcen_5127         CDS       T00363                                 

Definition
(GenBank) hypothetical protein
Organism
bcn  Burkholderia cenocepacia AU1054
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4123
Motif
Other DBs
NCBI-ProteinID: ABF80001
UniProt: A0A0H2XZQ9
LinkDB All DBs
Position
2:complement(2408917..2409819)
Genome map
AA seq 300 aa AA seqDB search
MTNDLIAAQAADALQAALLSQDGLRAYVLIDGALLDTLPDEDKASWPAFVAASLLDDADD
EARVVGPLLFEWQPAADSAEAADAIEPPGIPWPAASVLVSPLSLERLAAHLAPMVDVQLE
QMESVMLMRFFDPRVLPFWLDMLPAAHRAYLAQGVRHWIHRDTALQLRTADIAAPATVRQ
AAEFPLQLTQAQEDDLLAACYPYTMLERLRVEKPALLASLPAAQHYGFVRDQLARCQAHG
AESAASLLIYCELALRYGARFDEHPAMAAVFDAVAQGEAFPEALARVPAEDWRRMQEAAG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgacctgatcgccgcgcaggcggccgacgcgctgcaggcggcgctgttgtcg
caggacgggctgcgcgcttacgtcctgatcgacggcgcattgctggatacgttgccggac
gaggacaaggcgtcgtggcccgcgttcgtcgcggcctcgctgctcgacgacgccgacgac
gaggcgagagtcgtcgggccgctgctgttcgaatggcagcccgccgccgacagcgccgag
gctgcggacgcgatcgagccgcccggcattccgtggccggcggcgagcgtgctcgtgtcg
ccgctgtcgctcgagcgactggccgcgcatctggcgccgatggtcgatgtccagctcgag
cagatggagagcgtgatgctgatgcgcttcttcgatccgcgcgtgctgccgttctggctc
gacatgctgcccgccgcccatcgcgcgtatctggcgcagggcgtgcggcactggattcac
cgcgataccgcgctgcagctccggacggcggacatcgccgcgcccgccaccgtcaggcag
gccgccgagtttccgctgcagttgacccaggcgcaggaagacgatctgctcgccgcctgc
tatccgtacacgatgctcgagcggctgcgtgtcgaaaagcccgcgctgctggcgtcattg
ccggccgcgcagcactacggcttcgtgcgcgatcaactggcacgctgccaggcgcacggc
gccgaaagcgcggcgtcgctgctgatctattgcgaactggcgttgcgctacggcgcgcgc
ttcgacgagcatccggcgatggccgccgtgttcgacgcagtggcgcagggagaggcgttt
ccggaggcgctggcgcgggtgccggcggaggactggcggcggatgcaggaagcggccggg
tga

DBGET integrated database retrieval system