KEGG   Burkholderia cenocepacia AU1054: Bcen_5131Help
Entry
Bcen_5131         CDS       T00363                                 

Definition
(GenBank) Cupin 2, conserved barrel
Organism
bcn  Burkholderia cenocepacia AU1054
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ABF80005
UniProt: A0A0H2XYA3
LinkDB All DBs
Position
2:2415013..2415546
Genome map
AA seq 177 aa AA seqDB search
MVDKAVSEFWQNIPAIANPFKPDALPEAYIPNAATDDERYYVPFTETVSSRPLWISPSQN
KWCDILMAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDDAGNPDGYFDVHSYIAMCKAHYEKVGLGAQAVEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacaaagccgtatccgaattctggcaaaacattccggcgattgccaatccgttc
aagcccgatgcgctgcccgaagcctacatcccgaacgcggccaccgacgacgagcgctat
tacgttccgttcaccgaaacggtttcgtcgcggccgctgtggatctcgccgtcgcagaac
aaatggtgcgacatcctgatggcgaaggaagccgggctcgtgaaccggcactatcacccg
cacgaggtgttcgcgtacacgctgtcggggaaatggggttacctcgaacacgaatggacc
gcgacgcgcggcgatttcgtgtacgagacgccgggcgagggccacacgctcgtcgcgttc
gatcaccccgagccgatgcgcgcgttcttcatcgtcaagggcccgctgatctggctcgac
gacgcaggcaatcccgacggctacttcgacgtgcattcgtacatcgcgatgtgcaaggcg
cattacgagaaggtcggcctcggcgcgcaagcggtcgagaagctgttccgctga

DBGET integrated database retrieval system