KEGG   Burkholderia cenocepacia AU1054: Bcen_5132Help
Entry
Bcen_5132         CDS       T00363                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
bcn  Burkholderia cenocepacia AU1054
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp MFS_1_like
Motif
Other DBs
NCBI-ProteinID: ABF80006
UniProt: A0A0H2XZR4
LinkDB All DBs
Position
2:2415630..2416868
Genome map
AA seq 412 aa AA seqDB search
MTFGFVFFDRLALSFLFPFMSAELHLANTQLGMVSSALALTWALSGAATGAWSDARGTRK
PLLVAAVLGFSVCSALSGLVGGFASLIAFRALIGIAEGPVLPLSQSLMVESSTPSRRGLN
MGLLQGSAAGLLGAMIGPPVVIGIATAYGWREAFYVSCIPGFLIAFCIWRWVREVPPGGV
RHVHADTAAVPAASGAEFSRWALLKERNILLCVLISCFFLTWFVVIISFAPVFLVESRHL
APSDMGVVMTCLGAAWVFWGFAVPAISDRIGRKPTMIGFALIAAMCPVVLIHVGSVWALG
ALVFVTYTGLGCFTLFMATIPAETVPPRAIASALGLIMGAGELIGGFVAPTVAGFAADRY
GLQFAMWTSTTGAILACVLSFGLVETAPAVLRKRAPAGAAAGRLDTHNLGGR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcggcttcgtgttcttcgaccgcctcgcgctgtcgttcctgtttccgttcatg
tcggccgagctgcacctggcgaacacgcagctcggcatggtgtcgtccgcgctcgcgctc
acgtgggcgctgtcaggcgccgcgaccggcgcatggtccgacgcgcgcggcacccgcaag
ccgctgctggtcgcggccgtgctcggcttttccgtgtgctcggcgctgtcggggctcgtc
ggcggcttcgcgagcctgatcgcgtttcgcgcgctgattggcatcgccgaaggccccgtg
ctgccgctgtcgcaatcgctgatggtcgagagttcgacgccgagccgccgcgggctgaac
atgggcctgctgcaaggctcggccgccggcctgctcggcgcgatgatcggcccgccggtc
gtgatcggcatcgccaccgcatacggctggcgcgaggcgttctacgtgtcgtgcattccg
ggcttcctgatcgcgttctgcatctggcgctgggtgcgcgaagtgccgcccggcggcgtg
cgccacgtgcacgccgataccgccgcggtaccggccgcaagcggcgccgagttcagccgc
tgggcattgctgaaggagcgcaacatcctgctctgcgtgctgatcagctgcttctttctc
acgtggttcgtcgtgatcatctcgttcgcgccggtgttcctcgtggaaagccgtcacctg
gcgccgtccgacatgggcgtcgtgatgacctgcctcggcgccgcgtgggtgttctggggc
ttcgccgtgccggcgatctccgaccggatcggtcgcaagccgacgatgatcgggttcgcg
ctgatcgcggccatgtgcccggtcgtgctgatccacgtcggctcggtctgggcgctcggc
gcgctcgtgttcgtcacgtatacgggcctcggctgcttcacgctgttcatggcgacgatc
ccggccgaaacggtgccgccgcgagcgatcgcgagcgcgctcgggctgatcatgggcgcc
ggcgagctgatcggcggcttcgtcgcgccgaccgtcgccggcttcgcggcggacaggtac
ggcctgcagttcgcgatgtggacctcgactaccggcgcgatcctcgcatgcgtgctgtcg
ttcggcctcgtcgaaaccgcgccggccgtgctgcgcaagcgcgcgcccgcaggcgccgcg
gccggccgcctcgatacgcacaatctcggaggacgctga

DBGET integrated database retrieval system