KEGG   Burkholderia cenocepacia AU1054: Bcen_5139Help
Entry
Bcen_5139         CDS       T00363                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
bcn  Burkholderia cenocepacia AU1054
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AAA_16 AAA_22 TPR_12 Kdo NACHT
Motif
Other DBs
NCBI-ProteinID: ABF80013
UniProt: A0A0H2XZC8
LinkDB All DBs
Position
2:complement(2423128..2427177)
Genome map
AA seq 1349 aa AA seqDB search
MNAGEPAVLPTVSRALARPDAPEPPKHAVPFATLAGKWHYRLGPLLGEGGNGVVFRATCD
ETGHAVAIKLMRDDAALTVPERMHRRARFRRETSLCEALRHPNIVALLDRGEAPDGRLFA
VFELVEGRTVRDRLAADGPLSAIDTGRLMTQVLDALAAAHRRGIVHRDLKPQNIVIAVAD
DGPHAKLLDFGIGALLPGTEDIARQTATLATEVLGSPPYCAPEQLRNEPPTPASDLYAWG
LIVLECLTGEVVMQGASVAEILYQQLSPVDVALPPSIASLPLGAVLRHALNKNPRQRAAS
AEALATQFRALNFAALVGQFDAGRAGRKARSRPLAPRGETLAEVGEYRQITTLCCCVTIA
GEGRQRHAGTEHGMALDGYEEQWLTKCADIAVGYGAHAGGRLGDTLLFHFGLQGDIDRPA
RRAVRAALDMVRVAGRARLPVPPAAGGRAAEGEEGWRVEVAAAIHVGQVLAHASHMSGVS
TPAAASRLLRLAGPGQILISDDARLVLERHADSRPTALRLARAGLVSQPVHELLGERHAD
TPFDSLDAGRRTPMVGRAREFDALLRAWQDTLGRHRRALRGEPAPLGVPRLVVGEAGFGK
SRLVHELCEAVRTRGHAFAQCGCLPERENHALFPVLRFIAAHWLVDADRAPGVALAAIDA
MIAPLDCDHAAARVALATWLGLPCDANGLLWSSAREQHALFDVLEQLLVSLGNGAPVLLV
IEDVQWLDRSTEEFLAYLRRSPRAAALCIVLTSRPDRLARWRGAADRVVLRRLPRDDAQR
LMSAHLGPGAFDPAWLDRLADRTAGIPLFIEAVARELTVSGADGPLAGPAATDPYPLPLS
LGGMLGLAFDRIDDARDTAQLAATIGLEVDAQLLADASPHDRSTLDAHLRLLLEERIVYA
QHRRDRVFYAFRHALIRDAAYESMPPAVRRGNHARVGRALLARADRGAGAHAFGIAGHFA
RAGACADAIAQGIDAARRALEHSRYDDAIRYGQAVFDWLATADHAQREHDSARIRATLTH
ATMARFGWADPQIREHAEQLLRQTRTLDDPELEISALWTLSTYYHVAGDRPTVRRIGKRL
DTLATERGEAGVQVAADAMRGMSLWVDGDYARARAAFDAVLAGYDARRDAGHRRILGLDT
RAWTMASLASVRWCMDDDPQPSLAMAREAVYCATCLDHLPTLGVTMMYLARTHQLAGDRD
AARAVSEAILRLADAHRLRAVGHYAAIIHAWTQRDRAGVVAHLDAQRQSGGLLGLTYYAS
LLAELDAERGDYDAALAQIGECLAWCESSGERYYEAQLLLKQGEYLRRADPRCGGVAALD
ACRRAVEIATTAGMGRIARLAEATLQSLP
NT seq 4050 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgggagaaccggccgtgctgccgaccgtatcccgcgccctcgcccggccggat
gcacctgaaccgccgaagcacgcggtgccttttgcaacgctcgccggcaaatggcattac
cggctcggcccgctgctcggcgaagggggcaacggcgtggtgtttcgggctacctgcgac
gagacggggcacgccgtcgcgatcaagctgatgcgcgacgatgccgcgctgaccgtgccg
gagcggatgcaccggcgtgcgcgcttccggcgcgagacgagcctgtgcgaggcgctgcgg
catccgaacatcgtcgcgctgctggaccgcggcgaagcgcccgacggccggctgttcgcc
gtattcgaactggtcgagggccggacggtgcgcgaccggctcgcggcggacgggccgctg
tcggccatcgacacggggcggctgatgacgcaggtgctcgacgcgctcgcggccgcccat
cggcgcggcatcgtgcatcgcgatctgaagccgcagaacatcgtgatcgcggtcgccgac
gacgggccgcacgcgaagctgctcgatttcggcatcggcgcattgctgcccggcaccgaa
gacatcgcgcgccagaccgcgacgctcgcgaccgaagtactcggctcgccgccctactgc
gcgccggagcaattgcgcaacgagccgccgacgcccgccagcgacctgtatgcgtggggc
ctgatcgtgctcgaatgcctgacgggcgaggtcgtcatgcagggcgccagcgtggccgag
atcctctatcagcaactgagcccggtagatgtcgcgctcccgccgtcgattgcgtcgctg
ccgctcggcgcggtgctgcggcacgcgctgaacaagaatccgcggcagcgtgccgcgtcg
gccgaggcgctcgcgacgcagtttcgtgcgctcaacttcgcggcgctggtcggccagttc
gacgccggtcgcgccggtcggaaggcgcgttcgcgcccgcttgcgccgcgcggcgagacg
ctcgccgaagtgggcgagtaccggcagatcaccacgctgtgctgctgcgtgacgattgcc
ggcgagggccgccaacgccatgccggcaccgagcacggcatggcgctcgacggctacgag
gaacagtggctgacgaagtgcgccgatatcgcggtcggttacggcgcgcatgcgggcgga
cggctcggcgacacgctgctgttccatttcggcctgcaaggcgacatcgaccggcccgcc
cgccgggcggtgcgggcggcgctcgacatggtgcgcgtcgccgggcgcgcgcggttgccg
gtgccgccagccgccggcggccgtgctgccgagggtgaagaaggctggcgggtcgaagtg
gccgccgcgattcacgtcgggcaggtgctcgcgcatgcgtcgcacatgtcgggcgtctcg
acgcccgccgcggcgtcgcggctgctgcggctggccggccccggacagattctgatcagt
gacgatgcgcggctcgtgctcgaacggcatgccgattcgcggccgaccgcgttgcggctc
gcacgggcgggcctggtgtcgcagccggttcatgaattgcttggcgagcggcacgccgat
acgccgttcgattcgctcgacgccggcagacggacacccatggtcggccgcgcgcgtgag
ttcgacgcactgctgcgcgcgtggcaggacacgctcgggcggcatcgtcgcgcgctgcgc
ggcgagccggcgccgctcggcgtgccgcggctcgtcgtcggcgaggcgggcttcggcaag
tcgcggctcgtgcacgagctgtgcgaggccgtgcggacccggggccacgcgttcgcgcag
tgcggttgcctgccagaacgcgagaatcatgcgctgtttccggtcctgcggttcatcgcc
gcgcactggctcgtcgatgccgatcgcgcgccgggcgtggcgctcgcggcgatcgacgcg
atgatcgcgccgctcgattgcgaccatgcggcggcgcgtgtcgcgctcgcgacctggctc
gggctgccctgcgacgcgaacgggctcctgtggtcgagcgcgcgcgagcagcacgcgctg
ttcgacgtcctcgagcaactgctcgtatcgctcggcaacggcgcgccggtgctgctcgtg
atcgaggacgttcagtggctcgatcgttcgaccgaggagtttctcgcgtatctgcggcgc
tcgccgcgcgcggcggcactgtgcatcgtgctcacgtcgcgccccgacaggctcgcgcgc
tggcgcggcgcggccgaccgcgtggtgctgcgccgcctgccgcgcgacgacgcgcaacgc
ctgatgtcggcgcatctcggcccgggcgcgttcgatccggcgtggctcgatcggctcgcc
gatcgcaccgcgggcatcccgctgttcatcgaggccgtcgcgcgcgaactgacggtgagc
ggcgcggacggtccgcttgccgggcccgcggcaacggacccttatccgctgccgctcagt
ctcggcggcatgctcggtctggccttcgaccggatcgacgacgcgcgcgacaccgcgcag
ctcgccgcgaccatcgggctcgaagtggatgcgcaactgctcgccgatgcatcgccgcat
gatcgctccacgctcgatgcccatctgcggctgctgctcgaagagcggatcgtgtacgcg
caacatcggcgcgatcgcgtgttctatgcgttccgccatgcgctgattcgcgacgccgca
tacgaatcgatgccgccggcggtgcggcgcggcaaccacgcgcgcgtcggccgtgcgctg
ctcgcgcgggccgatcgcggcgccggtgcgcacgcgttcggcatcgccgggcacttcgcg
cgcgccggcgcgtgcgcggacgcgatcgcccaaggcatcgacgcggcgcggcgtgcgctc
gaacattcgcgatacgacgacgcgattcgctacgggcaggccgtattcgactggctcgcg
accgccgatcacgcccagcgcgagcacgacagtgcgcgcattcgcgccacgttgacgcac
gcgacgatggcgcgattcggctgggccgatccgcagatacgcgagcatgcggagcagttg
ctgcggcagacccggacgctcgacgacccggagctcgagatcagcgcgttgtggacgctg
tcgacctactaccacgtcgccggcgaccgtccgaccgtgcgccggatcggcaagcggctc
gacacgctcgcgaccgagcgcggcgaggcgggcgtgcaggtcgcggcggacgcgatgcgc
ggcatgagcctgtgggtcgacggcgactatgcgcgcgcccgtgccgcgttcgacgcggtg
ctggccggctacgacgcgcggcgcgacgcgggccaccggcgcatcctggggctcgatacg
cgtgcgtggacgatggcgtcgctcgccagcgtgcgctggtgcatggacgacgatccgcaa
ccgtcgctcgcgatggcgcgcgaggctgtgtattgcgcgacctgcctcgatcatctgccg
acgctcggcgtcacgatgatgtacctcgcgcgcacgcatcagctcgcgggcgaccgcgac
gcggcgcgagccgtgtcggaggcgattctccggctggcggatgcgcaccggctgcgcgcg
gtcgggcactacgccgcgatcattcatgcatggacgcaacgcgatcgcgcgggcgtcgtc
gcgcatctcgacgcacagcggcagtcgggcggcctgctcgggctgacctactacgcgtcg
ctgcttgccgagctggatgccgaacgcggcgactatgacgcggcgctcgcgcagatcggg
gagtgcctcgcctggtgcgaatcgagcggcgaacggtattacgaagcccagctgttgctc
aagcagggcgagtacttgcgccgcgccgatccgcgttgcggcggcgtggccgcgctggac
gcgtgccggcgcgcagtcgaaattgcaacgacggcgggcatgggccggatcgccaggctc
gccgaagcgacgttgcagtcgttgccgtaa

DBGET integrated database retrieval system