KEGG   Burkholderia cenocepacia AU1054: Bcen_6131Help
Entry
Bcen_6131         CDS       T00363                                 

Definition
(GenBank) Penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00550  Peptidoglycan biosynthesis
bcn01100  Metabolic pathways
bcn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bcen_6131
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Bcen_6131
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bcn01003]
    Bcen_6131
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcn01011]
    Bcen_6131
Enzymes [BR:bcn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Bcen_6131
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Bcen_6131
Glycosyltransferases [BR:bcn01003]
 Polysaccharide
  Bacterial polysaccharide
   Bcen_6131
Peptidoglycan biosynthesis and degradation proteins [BR:bcn01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Bcen_6131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ABF80995
UniProt: A0A0H2Y364
LinkDB All DBs
Position
3:723423..725942
Genome map
AA seq 839 aa AA seqDB search
MPIIKRPPSSSDRNEPHYTLRRSPSGAYYPDDDDRDDGRRAQQRSGGGGRRRTFGSRVAL
WFVGLFATLAVVGALIVGYALVVMAPQLPSLDALTNYQPKVPLRVFTADHVLIGEFGEER
RSLVRFQDIPDVMKKAVLAIEDYRFYEHGGVDFLGILRAGVADLMHGGARQGASTITMQV
ARNFFLSSEKTYTRKIYEMLLAYKIEKALTKDQILELYMNQIYLGQRSYGFAAAARVYFG
KDLKDITLAEAAMLAGLPKAPSAYNPVVNPKRAKVRQEYILKRMLDIGYITQPQYDEAIK
EEIHVRTPGNQYAVHGEYVAEMVRQMMYQQYKDETYTRGLTVTTTINSADQEAAYQAVRR
GILDYERRHGYRGPEASINLPAAGDERDEAIDDALADHPDNGDLQSAVVLSASPNAVEVQ
FVGGATTTIGPAGLRFVSAALGARANNALRIKPGSVVRVLKDGKTGWQVVQLPQVEGALV
AIAPQDGAIRSLVGGFDFNKSKFNHVTQAWRQPGSSFKPFIYSASLDKGLGPATMINDAP
LYFPPSVPGGTAWEPKDDDQPDGPMTMRTGLQRSKNLVSIRILASIGTQYAQQYVTQRFG
FDPAKTPPYLPMALGAGLVTPLQLATGYAVFANGGYKVDPYLIAEVDDARGQPLQKSQPV
VAGGTAPRTIEGRNAYVMNSLLHSVATAGTGAGTNALGRNDLQGKTGTTNDAKDGWFAGY
QQSLVAVAWMGFDQPKSLGSREFGAQLALPIWVNYMRTALNGVPEQQMPMPDGLTTIDGE
LYYADRTPGNGFVANVDINPAENAISANDALGSAGAAGLAPPPVTPQEKQQIMDMFESK
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgccaattatcaaacgaccgccttcttcttccgacaggaacgagccccactacacgctg
cgccgttcgccgtccggagcctattaccccgatgacgacgatcgcgacgacggccgccgc
gcgcagcagcgcagtggcggtggagggcgccggcgcacgttcggttcgcgcgtcgcgctg
tggttcgtcggcctgttcgcgacgctcgcggtcgtcggcgcgctgatcgtcggctacgcg
ctggtcgtgatggcgccgcaactgccgtcgctcgatgcgctgaccaattaccagccgaag
gtgccgctgcgcgtgtttaccgccgatcacgtgctgatcggcgagttcggcgaggagcgc
cgcagcctcgtgcgcttccaggacattcccgacgtgatgaagaaggccgtgctcgccatc
gaggactaccgcttctacgagcacggcggcgtcgatttcctcggcatcctgcgcgcgggc
gtggccgacctgatgcacggcggcgcgcgccagggcgcgagcacgatcacgatgcaggtc
gcgcgcaacttcttcctgtcgagcgagaagacctacacgcgcaagatctacgaaatgctg
ctcgcgtacaagatcgagaaggccctgacgaaggaccagatcctcgagctgtacatgaac
cagatctatctcggccagcgttcgtacggcttcgcggccgcggcgcgcgtgtatttcggc
aaggacctgaaggacatcacgctcgcggaagcggcgatgctcgcggggctgccgaaggcg
ccgtccgcgtacaacccggtcgtcaatccgaagcgcgcgaaggtgcgtcaggaatacatc
ctgaagcgcatgctcgacatcggctacatcacgcagccgcagtacgacgaggcgatcaag
gaagagatccacgtgcgcacgccgggcaaccagtacgcggtgcacggcgagtacgtcgcc
gagatggtgcggcagatgatgtaccagcagtacaaggacgaaacctacacgcgcgggctg
accgtcacgacgacgatcaactcggccgaccaggaagccgcgtatcaggccgtgcgtcgc
ggcattctcgactacgagcgccgtcacggctatcgcggccccgaagcgtcgatcaacctg
cctgcggccggcgacgaacgcgacgaggcgatcgacgatgcgctcgccgatcacccggac
aacggcgacctgcaatcggcggtcgtgctgtcggcatcgccgaacgcggtcgaggtgcag
ttcgtcggcggcgcgaccacgacgatcggcccggccgggctgcgcttcgtgtcggccgcg
ctgggcgcccgtgcgaacaacgcgctgcgtatcaagccgggctcggtcgtgcgcgtgctg
aaggacggcaagacgggctggcaggtggtgcagctgccgcaggtcgaaggcgcgctcgtc
gcgatcgcgccgcaggacggtgcgatccgctcgctcgtcggcggcttcgacttcaacaag
agcaagttcaaccacgtgacgcaggcgtggcggcagccgggctcatcgttcaagccgttc
atctactcggcgtcgctcgacaaggggctcgggccggcgacgatgatcaacgacgcgccg
ctgtacttcccgccgagcgtgccgggcggcaccgcgtgggagccgaaggacgacgatcag
ccggacggcccgatgacgatgcgcaccggcctgcagcgttcgaagaacctggtgtcgatc
cggatcctcgcgtcgatcggcacgcagtacgcgcagcagtacgtgacgcagcgcttcggt
ttcgatccggcgaagacgccgccttacctgccgatggcgctcggcgcgggcctcgtgacg
ccgttgcagctcgcgaccggctacgcggtgttcgcgaacggcggctacaaggtcgatccg
tacctgatcgccgaagtcgacgacgcgcgcggccagccgctgcagaagtcgcagccggtg
gtcgcgggcggcacggcgccgcgcacgatcgaaggccgcaacgcgtacgtgatgaacagc
ctgctgcattcggtcgcgaccgccggcacgggcgcgggcaccaacgcgctgggccgcaac
gacctgcagggcaagacgggtacgacgaacgatgcgaaggacggctggttcgccggctac
cagcagtcgctcgtcgcggtcgcgtggatgggcttcgaccagccgaagagcctgggcagc
cgcgaattcggcgcgcagctcgcgctgccgatctgggtgaactacatgcgcaccgcgctg
aacggcgtgcccgagcagcagatgccgatgccggacggcctgacgacgatcgacggcgag
ctgtactacgccgatcgcacgccgggcaacggcttcgtcgcgaacgtcgacatcaacccg
gcggagaacgcgatcagcgcgaacgacgccctcggttcggccggcgcggccgggctggcg
ccgccgcccgtcacgccgcaggagaagcagcagatcatggacatgttcgagagcaagtag

DBGET integrated database retrieval system