KEGG   Burkholderia cenocepacia AU1054: Bcen_6173Help
Entry
Bcen_6173         CDS       T00363                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00071  Fatty acid degradation
bcn00362  Benzoate degradation
bcn00650  Butanoate metabolism
bcn01100  Metabolic pathways
bcn01120  Microbial metabolism in diverse environments
bcn01200  Carbon metabolism
bcn01212  Fatty acid metabolism
Module
bcn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcen_6173
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcen_6173
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcen_6173
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Bcen_6173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored NAD_Gly3P_dh_N Pyr_redox_2 ApbA Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ABF81037
UniProt: A0A0H2Y142
LinkDB All DBs
Position
3:777137..779221
Genome map
AA seq 694 aa AA seqDB search
MAVDYSTRDGVAVITLNNPPVNGLGLSTRQGVMDALDRAARDPSVTAIVLTGAGRAFSGG
ADITEFNTPKALQEPTLHTVIRAVEASAKPVVAALHSVVMGGGLELALGAHYRVAAPGAQ
VALPEVKLGLLPGAGGTQRLPRAVGLETALNMIVSGAPVPSEQLAKSGLFDEMADGDLLD
AAVAFARKVGAQKGPHPRVRDRKIVHENAAGFIQFARNSARAAAPNYPALHKCIDAIEAG
VLNGFDKGSVAEREGFVALMMTPESRALRHAFFGERAASKIPDVPADTPLREIRRVGVIG
AGTMGGGIAMNFINAGLPVTLLETKQDALERGLATIRKNYDAQVKKGKLTQEKLDARLAL
ITPTLSYDDLKEADLIVEAVFEELGVKEQVFRKLDEVAKPGAILASNTSTLDVDKIAAFT
KRPQDVVGMHFFSPANVMKLLEVVRGAQTAKDVLATVMAVAKKIRKTAVVSGVCDGFIGN
RMIEQYIRQALFMLEEGALPAQVDRAIEKFGFAMGPFRMSDLAGNDIGWAIRKRRYVEQP
DLQYSKIADRLCEQGRFGQKTGAGWYDYVPGDRKAKPSSLVDEMVVAYSKERGVERRKIG
DDEIVERLVFALVNEGAKILEEKIASKASDIDMVYLTGYGFPLWRGGPMLYADTVGLYNV
ERAIRRYAAAPNGDAWQLAPSIAELAKAGRGFNG
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggattactcgactcgcgacggcgtggccgtcatcacgctcaacaatccgccc
gtcaacgggctcggcctgtcgacccgccagggcgtcatggacgcgctcgatcgcgccgcg
cgggacccgtcggtcacggccatcgtgctgaccggcgcgggccgcgcgttctcgggcggt
gccgacatcaccgaattcaatacgccgaaggcgctgcaggagccgacgctgcacaccgtg
atccgcgcggtggaggcgagcgcgaagccggtcgtcgcggcgctgcacagcgtcgtgatg
ggcggcggcctcgagctcgcgctcggcgcgcattaccgcgtcgcggcgcccggcgcgcag
gtcgcgctgcccgaggtgaagctcgggctgctgccgggcgcgggcggcacgcagcgcctg
ccgcgcgcggtcgggctcgaaaccgcgctgaacatgatcgtgtcgggcgcgccggtaccg
tcggagcagctcgcgaagagcgggctgttcgacgaaatggccgacggcgacctgctcgac
gcggccgtcgcgttcgcccgcaaggtcggcgcgcagaaggggccgcatccgcgcgtgcgc
gatcgcaagatcgtccacgagaacgcggcgggcttcatccagttcgcgcgcaattccgcg
cgggccgccgcgccgaattaccccgcgctgcacaagtgcatcgacgcgatcgaggccggc
gtgctgaacggtttcgacaagggcagcgtcgccgagcgcgagggtttcgtcgcgctgatg
atgacgccggaaagccgcgcgctgcgccacgcattcttcggcgagcgggcggcaagcaag
attcccgacgtgccggccgatacgccgctgcgcgagatccgccgggtcggcgtgatcggc
gcgggcacgatgggcggcgggatcgcgatgaacttcatcaacgcgggactgcccgtcacg
ctgctcgagacgaagcaggacgcgctcgagcgcggtctcgcgacgatccgcaagaactac
gacgcgcaggtgaagaagggcaagctcacgcaggagaagctcgatgcgcgcctggcgctg
atcacgccgacgctgtcctacgacgacctgaaggaggccgacctgatcgtcgaggccgtg
ttcgaggaacttggcgtgaaggagcaggtgttcaggaagctcgacgaagtcgcgaagccg
ggcgcgattctcgcgtcgaacacgtccacgctcgacgtcgacaagatcgcggcgttcacg
aagcgcccgcaggacgtggttggcatgcacttcttcagccccgcgaacgtgatgaagctg
ctcgaggtcgtgcgcggcgcgcagaccgcgaaggacgtgctcgcgaccgtgatggcggtg
gcgaagaagatccgcaagacggcggtggtgtcgggcgtgtgcgacggcttcatcggcaac
cggatgatcgagcagtacatccgccaggcgctgttcatgctcgaggaaggcgcgctgccc
gcgcaggtcgatcgcgcgatcgagaagttcggcttcgcgatggggccgttccggatgagc
gacctcgccggcaacgacatcggctgggcgatccgcaagcggcgctacgtcgagcagccc
gatctgcagtattcgaagatcgccgatcgcctgtgcgaacagggccgcttcggccagaag
acgggcgccggctggtacgactacgtgccgggcgaccgcaaggcgaagccgtcgtcgctc
gtcgacgagatggtcgtcgcgtattcgaaggagcgcggcgtcgagcggcgcaagatcggc
gacgacgagatcgtcgagcggctggtgttcgcgctcgtcaacgaaggcgcgaagatcctc
gaggagaagatcgcgtcgaaggcgtccgacatcgacatggtctacctgaccggctatggc
ttcccgctgtggcgcggcgggccgatgctgtacgcggatacggtcggcctctataacgtc
gagcgcgcgatccgccgctatgcggccgcaccgaacggcgacgcgtggcagctcgcgccg
tcgatcgcggaactggcgaaggccggccgcgggttcaacggctga

DBGET integrated database retrieval system