KEGG   Burkholderia cenocepacia AU1054: Bcen_6321Help
Entry
Bcen_6321         CDS       T00363                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
bcn  Burkholderia cenocepacia AU1054
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007 DUF2586
Motif
Other DBs
NCBI-ProteinID: ABF81184
UniProt: A0A0H2Y1G8
LinkDB All DBs
Position
3:934574..936010
Genome map
AA seq 478 aa AA seqDB search
MKIYDQFYIDGAWRKPAGTGTIDVIDSGTEAVIGRIPEGVASDAQDAIRAARAAFDAWAA
TPAATRAGYLRKIVERLQARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWKAYAKLAES
FEFEAQVGNSLVVREPVGVVAAITPWNYPLNQVTLKVAPALAAGCTVVLKPSEVAPLNAF
MLAEAIHEAGLPAGVFNLVCGYGPVVGEVLATDPDVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFATAVKGTVNACYLNAGQTCSAHTRMLVPEARYEEARELAK
TAAEAYVAGDPRQEATRLGALASAAQQQRVQTYIQRGIDEGAELVTGGTGLPEGLAKGFF
VKPTVFGRVDPKATIAQEEIFGPVLSIITYRDEDEAVRIANDSPYGLGGAVWAGSDERAM
RVARRIRTGQVDINGGTWNGAAPFGGFKQSGYGRENGVYGLDEYLEYKSMQLKPARPA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacgaccagttctacatcgacggcgcatggcgcaaaccggccggcaccggc
acgatcgacgtgatcgattcgggcaccgaagccgtgatcggccggattcccgagggcgtt
gcgtccgacgcacaggacgcgattcgtgcggcgcgcgcggcgttcgatgcgtgggcggcc
acgccggccgcgacgcgcgcgggctacctgcgcaagatcgtcgagcgcctgcaggcgcgc
agcgaggaactcgcgcagtcgatcaccggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtcggcggcccgatctacaactggaaggcgtacgcgaagctggccgaatcg
ttcgaattcgaggcgcaggtcggcaattcgctggtggtgcgcgaaccggtcggcgtcgtc
gcggcgatcacgccgtggaactacccgctcaaccaggtcacgttgaaggtcgcgccggcg
ctcgcggccggctgcacggtggtgctgaagccgtccgaagtcgcgccgctcaacgcgttc
atgctcgccgaagcgatccacgaggccgggctgccggccggcgtgttcaacctcgtgtgc
gggtatggcccggtcgtcggcgaggtgctggccaccgatccggacgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtggccgagctggcggccgcgggcgtcaag
cgcgtcgcgctggagctgggcggcaagtcggcgtcggtgatcctcgacgatgccgatttc
gcgacggcggtgaagggcacggtcaacgcgtgctacctgaacgctgggcagacctgctcc
gcgcatacgcggatgctggtgccggaggcccgctacgaagaagcgcgcgagctcgcgaag
accgcggccgaagcgtacgtcgcgggcgacccgcggcaggaggcgacgcgcctcggtgcg
ctggcgtcggccgcgcagcagcagcgcgtgcagacgtacatccagcgcggcatcgacgaa
ggcgcggaactcgtaacgggcggcaccggcttgccggaagggctcgcgaagggcttcttc
gtgaagccgaccgtgttcggccgggtcgatccgaaagcgacgatcgcgcaggaagaaatc
ttcgggccggtgctgtcgatcatcacctatcgcgatgaagacgaggccgtgcggatcgcg
aacgattcgccgtacgggctcggcggcgcggtgtgggccggcagcgacgaacgcgcgatg
cgcgtcgcgcgccgcatccgcaccgggcaggtcgacatcaacggcggcacgtggaacggc
gccgcgccgttcggcggcttcaagcagtcggggtatggccgcgagaatggcgtgtacggg
ctcgacgagtatctcgagtacaagtcgatgcagttgaagccggccaggccggcctga

DBGET integrated database retrieval system