KEGG   Bacillus cellulosilyticus: Bcell_0114Help
Entry
Bcell_0114        CDS       T01389                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bco  Bacillus cellulosilyticus
Brite
KEGG Orthology (KO) [BR:bco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bco03012]
    Bcell_0114
   03029 Mitochondrial biogenesis [BR:bco03029]
    Bcell_0114
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bco04147]
    Bcell_0114
Translation factors [BR:bco03012]
 Eukaryotic Type
  Elongation factors
   Bcell_0114
 Prokaryotic Type
   Bcell_0114
Mitochondrial biogenesis [BR:bco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bcell_0114
Exosome [BR:bco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bcell_0114
  Exosomal proteins of breast cancer cells
   Bcell_0114
  Exosomal proteins of colorectal cancer cells
   Bcell_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADU28405
UniProt: E6TSJ0
LinkDB All DBs
Position
147784..148974
Genome map
AA seq 396 aa AA seqDB search
MGKEKFDRSKTHANIGTIGHVDHGKTTLTAAITHVLHKKSGKGTAMAYDQIDGAPEERER
GITISTAHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSRQVGVPYIVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDIPVIAGSALKAL
EGDAQYEEKIHELMAAVDDYIPTPERDKDKPFMMPVEDVFSITGRGTVATGRVERGQLNV
GDEVSIIGLTEEPGKTTVTGVEMFRKLLDYAEAGDNIGALLRGTARDEINRGQVLAKPGT
ITPHTKFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGICQLPEGVEMVMPGDNVE
MTVELIAPIAIEEGTKFSIREGGRTVGAGVVASIQE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggaaaaatttgaccgttccaaaacacatgccaatattggtacaattggacac
gttgaccatggtaaaactacattaactgctgcaattacacacgtattacacaaaaaatct
ggtaaaggtactgcaatggcatatgaccaaattgatggtgctccagaagagcgtgagcgt
ggaattacaatttcaactgcacacgttgagtacgaaacagatactcgccactatgcgcac
gttgactgccctgggcacgctgactatgttaaaaacatgatcactggtgctgcacaaatg
gacggagctatcttagtagtatctgctgctgatggcccaatgccacaaactcgtgagcat
atcttactttctcgtcaagtaggtgttccatacatcgttgtattcttaaacaaagttgat
atggttgacgacgaagagttacttgaattagtagaaatggaagtacgtgaccttctttct
gagtacgacttccctggtgatgacattcctgtaatcgctggttctgctcttaaagcactt
gaaggtgatgctcagtatgaagaaaaaatccatgaattaatggctgctgtagatgattac
atcccaactccagagcgtgacaaagacaagccattcatgatgccagttgaggacgtattc
tcaatcactggacgtggtactgttgcaactggacgtgttgagcgtggacaattaaacgta
ggtgacgaagtatctatcattggtcttactgaagagccaggaaagactactgttactggt
gttgaaatgttccgtaagcttcttgactatgctgaagctggggataacattggtgcatta
ttacgtggtactgcacgtgatgagatcaaccgtggacaagtacttgctaagccagggact
atcactccacatacaaagttcaaagcggaagtttatgttctttcaaaagaagaaggtgga
cgtcacactccattcttcactaactaccgtccacagttctatttccgtacaacggacgta
actggtatttgccaacttccagaaggtgtggaaatggttatgcctggagacaacgttgaa
atgactgtagaattaattgctccaatcgctattgaagaaggtactaagttctctatccgt
gagggtggacgtactgttggtgctggcgttgtagcttcaattcaagagtaa

DBGET integrated database retrieval system