KEGG   Bacillus cellulosilyticus: Bcell_0339Help
Entry
Bcell_0339        CDS       T01389                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00473  D-Alanine metabolism
bco01100  Metabolic pathways
bco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bcell_0339
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Bcell_0339
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bco01011]
    Bcell_0339
Enzymes [BR:bco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Bcell_0339
Peptidoglycan biosynthesis and degradation proteins [BR:bco01011]
 Precursor biosynthesis
  Racemase
   Bcell_0339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Dimerisation
Motif
Other DBs
NCBI-ProteinID: ADU28625
UniProt: E6TV42
LinkDB All DBs
Position
362569..363714
Genome map
AA seq 381 aa AA seqDB search
MNSTNHFYRNTWVEVDLNAIRENVKNLKNHLPSHVHIMAAVKANGYGHSSVPVAEAALQA
GATYLGVALLDEAIELRENGIKAPILVLGYVSPKYVNVAAEYDIRLTVFQSEWVEEAAKV
LEADNKGKIACHVKIDTGMGRLGIRTKEEGNALIVKLKKYSLFTIEGLFTHYATADELDT
SYLELQQQRFKDMISWFEATWGAEVPMKHCGNSATALRFSSEYYNLVRYGISMYGLSPSE
EIKELLPFPLKQAFSLYSEITHIKKAEKGDGISYGATYKSPGEEWIGTIPIGYADGWIRA
NATGEVLVNGERVPIVGRICMDQMMVALKQPVQIGTKVTIIGKQGNSFITIDEVANRLNT
INYEIPCTIGSRVPRIMVDKK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaattctacaaatcatttttaccgaaatacatgggtggaagtagatttaaatgcgatt
agagaaaatgtaaaaaacttaaaaaatcaccttcctagtcatgtccatattatggcggca
gtaaaggcgaatggttatggacacagtagtgttcctgttgcggaagctgcattacaagct
ggtgcgacgtatttaggtgttgctttattagatgaagcgatcgaactaagagaaaatggg
attaaagcgccgattttagtacttggctatgttagtccaaagtatgtaaatgtagcggct
gaatatgatatacgcttaactgtttttcaaagtgagtgggtggaagaagcagcaaaagtg
ctcgaagctgacaacaagggaaaaatagcatgtcatgtaaaaatagatacaggaatggga
cgattaggtataagaacgaaagaggaaggaaatgctttaattgttaagttaaaaaaatat
tccttatttacaatagaaggcctatttactcattatgctactgcagatgaattagacacc
tcttatttagaacttcaacagcagcggtttaaagatatgatttcgtggtttgaagcaacg
tggggagcggaagttccaatgaagcattgtggaaatagtgcgactgctcttcgcttttca
agtgagtattataatttggtacgttacggaatatctatgtatggtctatcaccatctgag
gaaataaaggaactattacctttcccactcaaacaagccttttcattatatagtgaaata
actcatattaaaaaggctgaaaaaggtgacgggataagctatggcgcaacatataaatcc
cctggtgaggaatggataggtacaattcctattggatatgcagatggttggattagagca
aatgctactggagaagtattagtaaacggtgaaagagtaccaatcgtcggacgaatatgt
atggatcaaatgatggttgcgttaaaacagcctgtacaaataggaacgaaagtgacgatc
ataggaaaacaaggaaattcctttattacgatagatgaagtggctaatcgattaaacacg
attaattacgagattccttgtacgattggttcacgtgttcctcgtattatggtggataaa
aagtaa

DBGET integrated database retrieval system