KEGG   Bacillus cellulosilyticus: Bcell_2192Help
Entry
Bcell_2192        CDS       T01389                                 

Definition
(GenBank) multi-sensor hybrid histidine kinase
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco02020  Two-component system
bco02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcell_2192
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Bcell_2192
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bco01001]
    Bcell_2192
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bco02022]
    Bcell_2192
   02035 Bacterial motility proteins [BR:bco02035]
    Bcell_2192
Enzymes [BR:bco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Bcell_2192
Protein kinases [BR:bco01001]
 Histidine kinases
  CheA family [OT]
   Bcell_2192
Two-component system [BR:bco02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Bcell_2192
Bacterial motility proteins [BR:bco02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bcell_2192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA GAF_2 4HB_MCP_1 GAF GAF_3 HAMP OKR_DC_1_N TarH
Motif
Other DBs
NCBI-ProteinID: ADU30452
UniProt: E6U274
LinkDB All DBs
Position
2378028..2380751
Genome map
AA seq 907 aa AA seqDB search
MKIKTKLLLGFASIITIVLFIGVYVLFSLNEQRNELTNIVNENYERVSYANDIKFLNESI
ATNLREMLLFEETVEESILYDIKQSRSGISVAFDSLRDITTNEETRSNISHLSILNEQYD
TRINDMISLYNNGDTQEAIALLEKNNELRAELIAGILELNENEELTMQEAIAQSDEAYER
SLIILSSLLAISIIIVSSISVSVIKSVNKSIHKVRSVMTAVSTNSKEKLPRIQVKNNDEI
ADIANAYNDMAASLEQSTENEKKLNQSLIEDNWIKTSYAQLAEDLQGYHEVHKFGETFLR
HLAPLVKATYGVFYLIEDGKYLYKQAAYATDNTDIGKERIAIGQGLAGQCAADKTVMVVD
PVPDGYATTESGIGQASTRALVILPIVFEKRVIGVLELAKFESFTQLQMNLLEQVCNSLG
TSIQQILDHIKISDLLTESQTTTEELQTQSEELQQQQEELRMINEKLHEQYKESDQKTKE
LEKIKEDLEEKNKSIQLSSRYKSEFLANMSHELRTPLNSILILSQMLSENANGNLSKKQI
EHAETIYSSGKDLLDLINDILDLSKIESGKVEVYPEELFIEDMRAFVERQFHPIAEQKGL
QFNCYIHQETPSILYTDDQRLKQILKNLLSNAFKFTAQGTVRFEVHPSYSESTKVVFSII
DTGIGIPPEKQESVFEAFHQGDGTTTREYGGTGLGLSISRELANLLGGRIEVVSEDGKGS
TFSLYLPDYDKMSDADFVIAESEVASTNEDIVTITNPEIVEKVPSIVGEENVEKTKAVLE
NKVVLIVDDDMRNVFALTAALESQNMEVVFAENGSDAIEMLEGNKTIDIVLMDIMMPVMD
GYEAMKAIRTYEQFKELPIIALTAKAMKNDREKCIQAGASDYISKPVDMEQLLSLMKVWL
YEDRKRG
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaacaaagttactattaggttttgcctcgattattacaatcgttttattt
attggggtttacgtcctattctcgcttaacgaacagcggaacgaactaacaaatattgta
aacgagaattatgaaagagtaagctacgccaatgatataaagtttttaaacgaaagtatt
gctactaatttgagggaaatgcttttgtttgaagaaaccgttgaagaaagtattctctac
gatattaagcagagtcgctctggaatttcggttgcctttgatagcttacgagatattact
acaaatgaggaaacgagaagcaatatttctcatttatcaatattaaacgagcaatatgat
actcgaattaacgatatgatctcgttatataataatggagatacacaagaagcgattgca
ctgttagaaaagaacaatgaactaagagcagaattaatagccggtattttggaattgaat
gaaaatgaagaactaacgatgcaagaggcgattgcacaatctgatgaagcatacgagcgt
tctctcataatattatctagcttgcttgcgattagtattattatcgtatctagcatttca
gtttccgttataaaaagtgttaataaaagcatacataaagtgcgtagcgtgatgacagct
gtttcgactaactcaaaagagaagcttcctcgtattcaagtaaaaaataacgatgaaata
gctgatatagcaaacgcctataacgatatggcagcatctcttgaacaatcaacagaaaac
gaaaagaaattgaaccaatcattgattgaggataactggattaagacaagctatgcgcaa
ttagcagaagatttacaaggatatcatgaagtacataaatttggtgagacatttttacga
catttagctccactagtaaaggcaacatatggtgtcttttacttaatagaggacggcaag
tacttatataaacaagcagcatatgctactgacaatactgatattggaaaagaaagaatt
gccataggtcaaggattagccggacaatgtgctgctgataaaacggtaatggtagtagat
cctgtaccagacggctatgcaacgacagaatctggtattggacaagcttcaacaagagct
ctcgttatactaccgattgtatttgaaaaacgcgtcattggtgttttagagcttgctaaa
tttgaatcatttacacagttgcaaatgaaccttttagaacaagtgtgcaattctctagga
acaagtattcagcaaatattagatcatataaaaataagtgatctattaacggaatcgcaa
acaactacagaggagctacaaacacaatcagaggagttgcagcaacagcaagaagaatta
agaatgattaatgagaagcttcatgaacaatataaggaatctgatcaaaaaacgaaagaa
ttagaaaaaataaaggaagatttagaagaaaaaaataagagtatacaacttagctcgaga
tataaatcagagtttttagcaaatatgtcacatgagcttcgaacacctttaaacagtata
ttaattttgtcacaaatgcttagcgaaaatgcgaatggcaatttatcaaaaaagcaaatt
gaacatgcagaaacaatatattcttctgggaaagatttgttagatttaattaacgatata
ttagatttatccaaaattgaatctgggaaagtggaagtttatcctgaagaattatttata
gaagacatgagagctttcgtggaaagacaattccatcctattgcggaacagaaggggcta
caatttaattgttatattcaccaagaaacgccatccatcttatatacagatgatcaacgg
cttaaacaaatattgaaaaacttgttaagtaacgctttcaaatttactgcacaaggaacg
gtgaggtttgaagtgcatcctagttatagtgagtctactaaagttgtattttctattatt
gatactggcataggcattccgccggagaagcaagaaagtgttttcgaagcattccatcaa
ggagatggtacgactacaagagaatatggcggtacaggactagggctatcaattagtaga
gagctagcaaatttattagggggaagaatcgaggtagtgagtgaggatggtaaaggcagt
acattctccttgtatctgccagactatgataaaatgtccgatgctgattttgtcattgct
gagtctgaggttgcttcaactaacgaagatatagtcacaattactaatcctgaaatagtt
gaaaaagtaccatcaatagtaggagaagagaacgtcgaaaagacgaaagcagttttagaa
aataaagtagttttaattgtagacgatgatatgcgaaatgttttcgccttaacagcagcc
cttgaatcacaaaacatggaagtagtttttgctgaaaatggaagtgatgcaattgagatg
ttagagggcaacaaaacaatagacattgtattaatggatattatgatgcccgtgatggat
ggctatgaagcgatgaaagcaattcgaacatacgaacaatttaaagaactgcctattata
gccttaacagcaaaagcgatgaaaaatgatcgagaaaaatgtattcaagctggtgcatcc
gactatataagcaagccagttgatatggaacagctactatctttaatgaaagtgtggctc
tatgaggatagaaaaaggggctga

DBGET integrated database retrieval system