KEGG   Bacillus cellulosilyticus: Bcell_2423Help
Entry
Bcell_2423        CDS       T01389                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00260  Glycine, serine and threonine metabolism
bco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcell_2423
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Bcell_2423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C AlaDh_PNT_C Methyltransf_25 TrkA_N Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: ADU30680
UniProt: E6TS26
LinkDB All DBs
Position
complement(2619726..2620769)
Genome map
AA seq 347 aa AA seqDB search
MNKKSMRAIVKEKRGYGASLKEVPIPQIGDLDVLIQVKATSICGTDVHIYTWDEWSESRV
NPPYVFGHEFAGVVVEKGKLVNNVEVGDHVSAETHIVCGHCPQCLTGQAHICANTEIIGV
DRDGCFAEYVALPAENMWKNDPSLPFEVASIQEPMGNAVHTVLSGDVAGKTVAIIGCGPI
GIMAVGIAKAAGASQVIAFDLNEYRLQLAKKMGATTVVNAGDEDVLNIASQLTKGYGVDV
VCEMSGHPIAMNQGFKMVTNGGRVAILSLPVKPVEIDVTNDIVFKGVTVKGITGRRMYET
WQQVSGLLSSGQVDVTPMITHHFSLEDYEKGFDLMLQGKCGKVVLHP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaagtcaatgcgagcaattgtaaaggaaaaacgaggctacggggcatcatta
aaggaagtgccaattccccaaataggtgatttagatgtgcttattcaagtgaaagctact
tcaatttgtggtacggatgttcacatatatacttgggacgaatggtcggaaagtcgagta
aacccaccatatgtttttgggcacgaatttgcaggtgttgtagtggaaaaagggaaacta
gtaaacaatgtagaggtaggtgatcacgtatctgccgaaacacatatcgtttgtgggcat
tgtccgcaatgcttaaccggtcaggcacatatatgtgcaaatacggaaataatcggtgtt
gatcgagacggttgttttgcggaatatgttgcattaccggctgaaaatatgtggaaaaat
gacccttcattaccatttgaagtagcaagcatacaggagccaatgggaaatgcggtccat
actgttttatcaggtgatgtcgctgggaaaacagtagctattatagggtgtggtccaatt
ggaataatggcagtaggtattgcaaaggctgcaggtgcttcacaagtaattgcttttgac
cttaatgaatataggttgcaattagcaaagaaaatgggtgcgacaacagtggtgaatgca
ggggacgaagacgtattaaatatagcttctcaactaacaaaaggatatggcgtcgacgtt
gtttgtgaaatgagcggacatcctattgcgatgaatcaaggttttaaaatggttacaaac
ggaggaagagttgccatattaagtttgcctgtaaaacctgtagaaattgatgttacgaat
gatattgtatttaaaggggtaactgtaaaaggaataactggaagacgtatgtatgaaaca
tggcagcaagtatctggccttctaagttcagggcaagtagatgtaacaccaatgatcaca
catcatttttcattagaagattatgaaaaaggatttgatctcatgctgcaaggcaaatgt
gggaaggtagttttacatccataa

DBGET integrated database retrieval system