KEGG   Bacillus cellulosilyticus: Bcell_2549Help
Entry
Bcell_2549        CDS       T01389                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bco  Bacillus cellulosilyticus
Brite
KEGG Orthology (KO) [BR:bco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bco01001]
    Bcell_2549
Enzymes [BR:bco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Bcell_2549
Protein kinases [BR:bco01001]
 Serine/threonine kinases: Other
  Bacterial family
   Bcell_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo APH Kinase-like RIO1 PBP1_TM Haspin_kinase YrbL-PhoP_reg DUF3671 Pkinase_fungal CrgA Aa_trans
Motif
Other DBs
NCBI-ProteinID: ADU30806
UniProt: E6TTN7
LinkDB All DBs
Position
complement(2751509..2753527)
Genome map
AA seq 672 aa AA seqDB search
MMNKRINDRYHILRPIGGGGMADVYLARDIILDRDVAVKVLKPQFSDDEDFIKRFRREAQ
AATSLSHPNVVNIYDVGEEDKLYFIVMEYVSGYTLKDYIQQKGKLHVHEAIHIMEQITAA
IEHAHENHIIHRDIKPHNILIGKGGTAKVTDFGIARAISDATITHTNSVLGSVHYLSPEQ
ARGGHVTYKSDIYSLGIVMYEMLTGQVPFSGDTAVSVAIKHLQSTLPLIRDNDPSVPQSV
ENVVIKATAKDPQDRYETTGEMVTDIHTVFDHTRNAEKRLHIPIKDDEATRAVPVIGNGV
KLDDNQQTVEHQKTEDNVEEKKNKKGKKKKTRKFWITLSLLIAFFLVGIIYLAFSLIPRL
LHVDDVEIPDDLVGMEYEEVYDILTELELEVNREDRYSDEIEKGHVIAHTPSAGTLVKVG
YTVDVIVSDGIEPEPMVDVVGASRDWVERVLEDFLEIEWEYEESSDHDDDTVLRQSPEAG
ELIIPGETIVTITLSQRPTFVMPNLNGLNRDEVIDSLASHPLLILHLDEEQYHPSIEKGR
VISQNPDRGTEIREQTEVKVIFSLGPEPEEEPEDLPITVTVPYPVDYDEIEDILGEDEGE
EEDNESYSVRISIIDMNNSTPRRVVDRDITSNEQFYIPMTVAPNASGFILLYVNGEEFAE
HEYTYEELKEYE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgatgaataaaagaattaacgaccgttaccacatccttagaccgattggtggcggaggt
atggcagatgtctatttagctagagatattattctagaccgagatgttgctgttaaagta
ctgaagccacagttttctgatgatgaagattttattaaaaggtttcgtagagaggcacaa
gctgctactagtctatctcaccctaatgtcgtcaatatttatgatgtaggtgaagaggac
aagctttactttatagtgatggaatacgtatcaggatatacactaaaagactatatacaa
caaaagggtaagctacatgtccatgaagcaatacatattatggagcaaattacagccgca
attgaacatgctcatgagaaccatattatccatcgagatattaagccacacaacattctc
attggaaaagggggaacggcaaaggttaccgattttggtattgcacgagcaataagtgat
gctactattacgcatactaactctgtactaggatctgtacactatttgtcacctgaacaa
gctcgtggtggacatgtgacctacaaatctgacatttactcactagggatcgtcatgtac
gaaatgcttactggtcaggtgccttttagtggtgataccgcagtgtctgtagctattaaa
cacttacaaagcacattaccattaatcagagataatgatccgtcagttccacaaagtgtt
gaaaatgtggttataaaggctactgcaaaggaccctcaagatcgatatgaaacaacaggt
gaaatggtgactgatattcacaccgtttttgatcacacacgcaatgcagaaaaaaggcta
catattccgatcaaagatgatgaagccactagagctgttccagttattggtaatggcgta
aaactagatgacaatcaacaaacagttgaacatcaaaaaacagaggacaatgtagaagaa
aaaaagaacaagaagggtaaaaagaaaaaaacaagaaaattttggattacattaagcctt
ttaatcgcattctttttagttggtatcatttatttggcattttcactgattcctagatta
ctacatgtagacgacgttgagataccagatgatttagttggaatggaatacgaggaagta
tatgacatattgactgaattagaactagaggtgaatcgtgaagatcgttatagtgatgaa
atagaaaaaggtcatgtaatagcacatacaccttctgcaggaacgcttgtaaaggttggt
tatacagttgatgtcatcgtcagtgatggtattgaacctgagccaatggttgatgtagta
ggagcatcaagagattgggtagaaagggtattagaagactttttagaaatagaatgggag
tacgaagaatcatctgaccatgatgatgacacagtattaaggcaaagtcctgaagctgga
gagttaatcattccaggtgaaacaatcgttacgataacgttgagccagaggccaacattt
gtaatgcctaacttaaacggattaaatagagatgaagttattgattccctagcaagtcat
ccgcttttaattttacatttagatgaggaacaatatcacccctccattgaaaaaggaaga
gtgatttcacaaaatcctgatcgaggaacggaaataagagaacaaacagaggtgaaggtt
atcttttcacttggtcctgaaccagaggaagaacctgaagatttgccaattacagtaacg
gtaccgtatccggtagattacgatgaaatagaggatatattaggtgaggacgaaggtgaa
gaggaagataacgaatcttatagtgttcgtatttccattattgatatgaataatagtacg
ccaagacgtgttgtagatagggatattacaagcaacgaacagttttatattcctatgacg
gttgcaccaaatgcctctggatttatcctcctatatgtgaatggagaagaatttgcagag
catgaatacacttacgaagaactgaaagaatatgaataa

DBGET integrated database retrieval system