KEGG   Bacillus cellulosilyticus: Bcell_3421Help
Entry
Bcell_3421        CDS       T01389                                 

Definition
(GenBank) lipoic acid synthetase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00785  Lipoic acid metabolism
bco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Bcell_3421
Enzymes [BR:bco01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     Bcell_3421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM LIAS_N TGT Flagellar_put
Motif
Other DBs
NCBI-ProteinID: ADU31663
UniProt: E6U2F0
LinkDB All DBs
Position
complement(3655544..3656425)
Genome map
AA seq 293 aa AA seqDB search
MSKQEEYVRKPEWLKIKLNTNESYTGLKKMMREKKLHTVCEEARCPNIHECWAERKTATF
MILGDTCTRACRFCAVKTGLPTELDRQEPERVADSVAQMGLKHTVITAVARDDLKDGGAE
IFAETVKAIRRKNPFTTVEVLPSDMGGKEENLKILMDAKPDILNHNIETVKRLTPRVRAR
ATYERSLEFLRRAKEMKPNIPTKSSLMIGLGETKEEIIETMDDLRANNVDIMTIGQYLQP
TKGHLKIVKYWTPEEFRELRDIALSKGFKHCESGPLVRSSYHADEQVNAAEQR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagcaagaagaatatgtgcgtaaaccggaatggttaaagataaaattaaataca
aatgaatcttatacaggattgaaaaaaatgatgcgcgagaaaaaattacatacagtgtgt
gaagaggcacgctgccctaatattcatgaatgctgggctgaaagaaaaacagcaacattc
atgatcttaggagacacttgtactcgtgcttgtagattctgtgctgttaaaactggactt
ccaaccgaattagatcgtcaagagccagaacgtgtagctgattcagtagcacaaatggga
ttaaaacatacggttataacagctgtggcaagggatgatttaaaagatggtggtgctgaa
atatttgcagaaacagtaaaagccattcgtcgaaaaaatccttttacgactgtcgaagta
cttccgtcagacatgggtggaaaagaagaaaatctaaaaatattgatggatgcgaagccc
gatattttaaatcataatattgaaacagtgaaaagacttacaccaagagtaagagcaaga
gcaacatatgagagatcattagaatttttgagaagagcgaaagaaatgaagccaaatatt
cctactaaatcaagtttaatgattggtttgggcgagacgaaagaggaaattatagaaaca
atggatgacttgcgtgcaaataacgttgatatcatgactataggtcaatatttgcagcct
acaaagggacatttaaaaatagtcaaatattggaccccagaagagtttcgcgagctaaga
gatatcgcattaagtaaaggctttaagcattgcgaatctggcccactcgtaagatcttct
tatcatgctgatgaacaagtaaatgctgctgaacagcgataa

DBGET integrated database retrieval system