KEGG   Bacillus cellulosilyticus: Bcell_4250Help
Entry
Bcell_4250        CDS       T01389                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bco  Bacillus cellulosilyticus
Brite
KEGG Orthology (KO) [BR:bco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bcell_4250
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bcell_4250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like FAD_binding_3 DAO AlaDh_PNT_C Thi4 NAD_binding_8 Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ADU32477
UniProt: E6TZ34
LinkDB All DBs
Position
4592315..4593841
Genome map
AA seq 508 aa AA seqDB search
MLEAEIKQQLEQYLQLLENDIVLKVSVSDDNVSKEMLSLVNEIADMSSKITVEQVELYRT
PSFSVNRVGEDTGVTFAGIPLGHEFTSLVLALLQVSGRAPKVDQSAIDQIKSIEGEFHFE
SYVSLSCHNCPDVVQALNVMSVLNPGITHTMIDGAAFKHEVESRDVMAVPTVYLNGEFLT
SGRASLEELLAKITDAPDASHFEDKDPFDVLVVGGGPAGSSAAIYAARKGIRTGIVAERF
GGQIMDTLSIENFISQKYTEGPKLAASLEEHVKEYNIDVMNLQRAKRLEKKDLVELELEN
GAVLKSKSVIISTGARWRNVGVPGEAEFKNKGVAYCPHCDGPLFEGRDVAVIGGGNSGIE
AAIDLAGIVKHVTVLEFMPELKADEVLQERLYSLPNVTVVKNAQTKEIIGDDKVNGITYI
DRDTEEEHHVELAGVFVQIGLVPNTEWLDGVIERNRFGEILVDRHGATNVPGVFAAGDCT
DSAYKQIIISMGSGATAALGAFDHLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctagaagctgaaataaagcaacaattagagcaatacttacaattactagaaaacgac
atcgttttaaaggtaagcgtgagcgatgataacgtttcaaaagaaatgttatcgttagtg
aatgaaatcgctgatatgtcgtcaaaaattactgttgaacaagttgagctatatagaaca
ccaagctttagcgtcaaccgtgttggtgaagatactggtgttacattcgctggtattcct
ttaggacatgagtttacttcattagtgctagctctactccaagttagtggtagagcacct
aaggttgatcaaagtgctattgatcaaattaaaagcattgaaggagaattccattttgaa
tcatacgtaagcttaagctgtcacaactgtcctgacgttgtacaagcacttaacgtcatg
agcgtccttaacccaggaattacacacactatgattgatggtgctgcatttaagcatgag
gttgaaagtagagacgtcatggctgtgccaacagtatatttaaatggtgaatttttaacg
agtggccgtgcatcacttgaggagcttcttgcaaaaatcacggatgcaccagatgcatct
cattttgaggataaagatccattcgatgtcctcgttgttggtggtggtccagcaggttca
agtgcggctatttatgcagcgagaaaaggtattcgtactggtattgttgcagagcgcttc
ggtggtcaaattatggatacacttagtattgaaaacttcattagtcaaaaatatactgaa
ggtcctaagcttgcagctagtcttgaggagcatgtgaaggaatataatattgatgtaatg
aatttacagcgtgcaaaacgcttagagaaaaaagaccttgttgaacttgaacttgaaaat
ggtgcagttcttaaaagtaagagtgtcatcatttcaactggtgctcgctggcgtaatgtt
ggtgtccctggtgaagcagagtttaaaaacaagggcgtagcatattgccctcactgtgac
ggtccgttatttgaaggtagagacgtagctgttatcggcggtggtaactctggtatcgaa
gctgcaattgatcttgcaggtatcgtaaagcatgtaacagtacttgagttcatgcctgag
ctaaaggctgatgaagttttacaagagcgcctatatagcttaccaaatgtaactgtcgtt
aaaaatgcacaaacgaaggaaatcataggggacgataaagtgaacggtattacgtatatt
gatcgtgatacagaagaagagcatcacgttgaattagcaggtgtttttgttcaaatcggt
cttgtccctaataccgaatggctagatggtgtcatagaacgtaaccgctttggtgaaatt
ctagtggatcgccacggtgctacaaacgttccaggtgtttttgcagctggtgattgtacg
gatagtgcatataagcaaatcattatttctatgggatcaggtgcaacagcagcattaggt
gcttttgaccaccttatccgaaattag

DBGET integrated database retrieval system