KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_1235Help
Entry
BF29_1235         CDS       T03712                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
bcoa00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BF29_1235
Enzymes [BR:bcoa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BF29_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Bclx_interact
Motif
Other DBs
NCBI-ProteinID: AJH77474
UniProt: A0A0B5X3A6
LinkDB All DBs
Position
complement(1187370..1188839)
Genome map
AA seq 489 aa AA seqDB search
MEKYLNYIDGEWCKPSTGKFAPVVNPANRKTLGEVAQSEARDLDRAVQAAKSAQSMWRLV
PAPERANYLYKVGELLKQRKEQIARTLTSEMGKVIDEARGEVQEAIDMAFYMAGEGRRQF
GDTVPSELQNKFAMSIRVPVGVAGLITPWNFPIAIASWKSLPALVTGNAVIWKPATETPA
TACAFVKIYEEAGLPKGLVNLVHGSGSVIGGAMVEHPGIGLISFTGSNEVGRKINERAGG
LLKRTSLEMGGKNAVIVMDDADLDLAVDGILWGAFGTSGQRCTATSRVIAHEKIKDALEE
KLIRRTAELKIGDGLDETVAVGPVINVEALDRIHQYVETGKKEGARLLTGGRILPGKGYY
YAPTVFTDVSPEMVIAQEEIFGPVVSIIPVAGLEEAIAVNNSVTFGLSSGIFTKDVNKAF
QAMRDLDTGIVYINAGTTGAEIHLPFGGTKGTGNGHRDSGPAALDVYTEWKAVYVDFSGK
LQRAQIDNH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatttgaattacattgacggcgagtggtgcaaaccgtcaacgggaaaattt
gccccggttgtaaatcctgcaaacaggaaaacattgggcgaagtggcgcagtccgaagca
cgggaccttgaccgcgccgtccaggctgccaaaagcgcgcaaagcatgtggcggctcgtt
ccggcacctgagcgcgcaaactatttatacaaagtcggagaactgttaaaacaaagaaaa
gaacagatcgcgcgcacgcttacaagcgaaatgggcaaggtgatcgatgaagcgcgcggg
gaagtgcaggaagcgatcgacatggcattttacatggcaggggaagggagacgccaattc
ggtgataccgtgccatctgagctgcaaaataaatttgcgatgagcatccgtgtgccggtt
ggcgttgccgggctgatcacgccgtggaattttccgatcgccattgcttcctggaaatca
ctgccggcgcttgtaacggggaatgcggtgatttggaagccagctacggaaacgccggcc
acagcatgcgcatttgtaaaaatttatgaagaagcgggactcccaaaagggcttgtcaat
cttgtccacggctccggttccgtgattggcggagcgatggtggaacatccgggcatcggc
ctcatctcttttaccggctcgaatgaagtcgggcgtaaaatcaatgaacgggcaggcggc
cttctgaaacggacttcgcttgaaatgggcgggaagaacgcagtgattgtcatggacgat
gcggatcttgatctagcggtggacggcatcctttggggtgcatttggcacgagcgggcaa
agatgcacggctacaagccgggtcattgcccatgaaaagatcaaagatgcactagaagaa
aagctgatccggcgaacggcggaattgaaaatcggcgacggcctcgatgaaacggtggca
gtcggcccggttatcaatgtagaagcgctcgaccgcatccaccagtatgttgaaaccggc
aaaaaagaaggggcaaggctgcttacaggcgggcgcattttgccgggaaaaggatattac
tatgcgccgaccgtttttacggatgtcagcccggaaatggtcattgcacaggaagaaatt
ttcggcccggttgtttcgatcattccggtagcaggccttgaagaagcgattgccgttaac
aacagcgtcacgttcgggttatcgagcggcatttttacaaaagatgtgaataaagctttt
caggcgatgcgtgatttggataccgggattgtctacatcaatgccgggacgacgggggct
gaaatccatctcccgttcggcgggacaaaaggaacgggcaacgggcaccgcgactcgggg
cccgcagcgcttgatgtatacacggaatggaaagccgtgtatgtcgatttcagcgggaaa
ctgcagcgcgcccagatcgacaatcattaa

DBGET integrated database retrieval system