KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_1406Help
Entry
BF29_1406         CDS       T03712                                 

Gene name
queG
Definition
(GenBank) epoxyqueuosine reductase
  KO
K18979  epoxyqueuosine reductase [EC:1.17.99.6]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcoa03016]
    BF29_1406 (queG)
Enzymes [BR:bcoa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.6  epoxyqueuosine reductase
     BF29_1406 (queG)
Transfer RNA biogenesis [BR:bcoa03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BF29_1406 (queG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1730 Fer4_16 HEAT_2 HEAT_PBS Fer4_9 Fer4_6 Fer4_7 Fer4 Fer4_21 RICTOR_V HEAT_EZ Fer4_10 Fer4_3 Fer4_2 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AJH79350
UniProt: A0A0B5WTW2
LinkDB All DBs
Position
complement(1361835..1362965)
Genome map
AA seq 376 aa AA seqDB search
MDTAELKKEIIAFSKKIGIDKIGFASPDPFTELKQRLIRQQELGYQSGFEEKDIEKRVNP
SLIFDSPQSIIAVALAYPSKIKDPPKGKKGARRGIFCRASWGEDYHTILRDKLSKLEDFL
KEKVEGARCKSMVDTGELSDRAVAERAGIGWSGKNCSIITPEFGSYVYLGEMITNIPFEP
DTPVEDQCGDCRKCLDVCPTGALVSAGQLNAKRCISFLTQTKDYLPDEFKGKIGNRVYGC
DSCQTICPKNKGMDFHFHEEMEPEPETAKPLLEPILRLSNRAFKERFGHMAGSWRGKKPI
QRNAMIALAHFKEESAVPELIRILQEDPRPVIRGTAGWALGKIGGEEAKAALLSAREQEE
DPDARNEIEKGLAFFE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggatacggccgaattgaaaaaagaaatcattgccttcagcaaaaagatcgggatcgat
aaaatcggttttgcctctccggatccgtttacagagctgaagcagcgccttatccgccag
caggaactcggctaccagtccggttttgaggaaaaagatattgaaaaaagggtgaatcct
tctttgatttttgattcgccccagtcgattattgccgttgcgctcgcctatccgtcaaaa
atcaaagatccgccgaaagggaaaaaaggcgcacgccgtgggatcttttgccgggcttca
tggggggaggactatcacaccattttaagggacaagctttcgaaactggaagattttctt
aaagaaaaagtggaaggggcccgctgcaaatcaatggtcgatacaggggaactctccgac
cgggcggtagctgagagggccggcataggctggagcggaaaaaattgttcgatcatcaca
ccggaatttggttcctatgtgtacttaggcgaaatgattaccaatattccgtttgaaccg
gatacgcctgtcgaggaccagtgcggggactgccggaaatgcctggacgtctgcccgacc
ggcgcgcttgtttctgccgggcagctcaatgcgaaacggtgcatcagctttttaacgcag
acaaaagattacctgccggatgagtttaaagggaagatcggcaaccgcgtgtacggttgt
gattcgtgccagaccatctgtccgaaaaacaaagggatggattttcattttcatgaggaa
atggagccggaaccggaaacggccaaacctcttctggaaccgattctccgcctcagcaac
cgcgcgtttaaagaacggttcggccatatggcaggatcgtggcgcgggaaaaagccgatc
cagcgaaatgcgatgatcgcgctcgcccattttaaggaagaaagcgcggtaccggaactg
atccggattttgcaggaagatccgcgcccggttattcgcgggacggctggctgggcgctt
gggaaaatcggcggggaagaagcaaaagcggcacttctttccgcacgcgaacaggaagaa
gatccggatgcccgcaatgaaatcgaaaaaggccttgcctttttcgaatag

DBGET integrated database retrieval system