KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_1410Help
Entry
BF29_1410         CDS       T03712                                 

Gene name
tcyA
Definition
(GenBank) L-cystine-binding protein tcyA
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
bcoa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BF29_1410 (tcyA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcoa02000]
    BF29_1410 (tcyA)
   02035 Bacterial motility proteins [BR:bcoa02035]
    BF29_1410 (tcyA)
Transporters [BR:bcoa02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    BF29_1410 (tcyA)
Bacterial motility proteins [BR:bcoa02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BF29_1410 (tcyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd Lig_chan-Glu_bd NMT1 LPAM_1
Motif
Other DBs
NCBI-ProteinID: AJH77685
UniProt: A0A0B5WP04
LinkDB All DBs
Position
1366233..1367030
Genome map
AA seq 265 aa AA seqDB search
MRKYIKWLAVFSLLFALTACGKNTDNQNASKSNDLYDQIKSKGVLLIGTEGTYPPFSFHK
NGKLTGYDIDVAKEVAKRLGLKAEFKETQWDAMFAGLNSKRFDMIANQVGIRADRQKKYD
LSTPYTISKAVVLVRKDNTNIKSFADLKGKKSAQSLTSNYADIAKKNGANIVSVEGFNQA
VQLLTSNRVDATVNDSLTYLDYKKQKPNAAIKVAATANEASKSAFLFRKHSGKLTDKVND
ALKDMKKDGTLTKISKKWFGEDVSQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatacatcaaatggctggccgtgttcagcttgctgtttgctttaacggcatgc
ggaaaaaatacggacaaccagaacgcttcaaaatccaatgacttatacgaccagatcaaa
tcaaaaggcgtccttttgatcggaacagaaggaacgtacccgccattttctttccataaa
aacgggaaattaacaggctacgatattgatgttgcgaaagaagttgcaaaacggctcgga
ttaaaagccgaatttaaagaaacacagtgggatgccatgtttgccgggctcaattccaaa
cggtttgatatgatcgcaaaccaagtcgggattcgcgcagaccgccagaaaaaatatgat
ttatcaacaccctatacgatttcaaaagccgttgtccttgtccgcaaagacaatacgaac
atcaagtcctttgctgatttaaaaggcaaaaaatcagcccaatcgcttacaagtaactat
gctgatattgccaagaaaaatggcgccaatattgtaagtgtggaaggatttaaccaagcg
gtccagcttttgacttcaaaccgtgtggatgccaccgtcaatgattccctgacctatctg
gactacaaaaagcaaaaaccgaatgctgccattaaagttgccgctacagcaaacgaggca
agcaaatccgcttttttgttccggaaacattcagggaaactgacagacaaagtaaatgat
gctttgaaagatatgaaaaaagacggcacgttaacaaaaatttcaaagaaatggtttggt
gaagatgtttcccaataa

DBGET integrated database retrieval system