KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_1994Help
Entry
BF29_1994         CDS       T03712                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
bcoa00473  D-Alanine metabolism
bcoa01100  Metabolic pathways
bcoa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BF29_1994 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BF29_1994 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcoa01011]
    BF29_1994 (alr)
Enzymes [BR:bcoa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BF29_1994 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bcoa01011]
 Precursor biosynthesis
  Racemase
   BF29_1994 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJH79015
UniProt: A0A0B5WSX0
LinkDB All DBs
Position
complement(1928015..1929166)
Genome map
AA seq 383 aa AA seqDB search
MAFYRDTWVEVDLDAISENVGNMRRLLPEHTQIIAVVKANAYGHGAEYVAKTALASGASA
LAVAFLDEALALRKKGITAPMLVLGATRPEDAGIAAEENISLTVFQKDWLEEASWYLTGR
KLSVHLKCDTGMGRIGVRTVQELKEVEKIVNQQSCFFFEGIFTHFATADEIDMTLYEKQY
SRFQDMVLNLETRPPYVHCANSAAALRFDQSPFNAVRFGIAMYGLSPSPEIKPVLPFPLK
EAFSLHTKVTHVKQIHAGDTVSYGATYQASGDEWIATLPIGYADGWIRRLSGQEVIIGGE
RAPIVGRICMDQCMVRIPRPVAVGTKATLIGKQGDLSVPVDEIAKKLDTINYEVTCSISS
RVPRVFRKNGNDAAGVSNPVLEG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggctttttaccgggatacatgggtggaagtcgatttggatgccatttcggaaaatgtc
ggaaatatgcgccgccttttgccggagcatacgcaaatcattgcggttgtaaaagccaac
gcttacgggcacggcgcggaatatgtggcgaaaaccgcgcttgcatccggagcttcagcg
ctggcggttgcatttttggacgaggcgctcgcgttgcgaaaaaaagggattaccgccccg
atgcttgttttgggggcaacccgtccggaagatgccggaattgcggctgaagaaaacatc
tccctgactgtttttcaaaaagactggctcgaggaagcaagctggtatttaaccgggcgg
aaactatccgtccatcttaaatgtgataccggaatgggccggattggcgtaagaaccgta
caggaattaaaagaagtggaaaaaatcgtgaaccaacaatcttgtttcttttttgaaggg
atttttacccactttgcgacagcggatgaaatcgatatgactttgtatgaaaagcaatac
agccggtttcaggatatggttttaaacctcgaaacccgcccgccgtatgtgcactgcgca
aacagcgccgccgctttgagatttgaccagtctccgtttaatgctgtccgtttcggcatt
gcgatgtacgggctctccccttcgcccgaaatcaagccggttttgccgtttccgttaaaa
gaggcgttctccctccatacaaaggtcacgcatgtgaaacaaatccatgccggggatacg
gtgagttacggcgcaacctatcaggcttccggcgatgaatggatcgccacgcttccgatc
ggatatgcggatggctggatccgcaggctctcaggccaggaagtgatcatcggcggggaa
agagcgcctattgtcggcaggatttgcatggatcagtgtatggtaaggatcccccgtccg
gttgctgtcgggacaaaagcaacgctgattggaaaacagggggatttgtccgttcctgtt
gatgaaattgccaaaaagctcgataccatcaactatgaggtgacctgttccatttcaagc
cgggtcccgcgcgttttccggaaaaacgggaacgatgccgcgggcgtgtcgaatccggtc
cttgaagggtga

DBGET integrated database retrieval system