KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_2013Help
Entry
BF29_2013         CDS       T03712                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
bcoa00473  D-Alanine metabolism
bcoa00550  Peptidoglycan biosynthesis
bcoa01100  Metabolic pathways
bcoa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BF29_2013
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BF29_2013
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BF29_2013
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcoa01011]
    BF29_2013
Enzymes [BR:bcoa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BF29_2013
Peptidoglycan biosynthesis and degradation proteins [BR:bcoa01011]
 Precursor biosynthesis
  Amino acid ligase
   BF29_2013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AJH77182
UniProt: A0A0B5WZ53
LinkDB All DBs
Position
complement(1952258..1953325)
Genome map
AA seq 355 aa AA seqDB search
MKKKICLLYGGKSAEHEVSLQTAKAVIQALDHEKYDIYPIFITTEGDWIKGPLLTGPVET
VKQLEFHDGKKMAPNALLTTVSDEKGGYDIIFPLLHGPNGEDGTVQGMLELLNLPYVGNG
VLASSAGMDKVIMKNLFAQAGLDQVKYVSFIRSEWEKAPETCFQQVEEKTGYPCFVKPAN
LGSSVGISKCKDRTELEAAFKEAFQYDRKIIVEEGVTAREIELGVIGNDDPQCSVAGEIV
AKKDFYDYKAKYEDGDTALIIPAEISETVYKKLTEAAITAFKALDCSGLVRADFFVTEDE
RVIINEINTMPGFTPFSMFPLLWKEAGLDYPQLIEKLIELALERHAEKQRIKYTL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaatctgtttgctttacggcggaaaatccgctgagcatgaagtatccctg
caaaccgccaaagctgtaatacaggccttggatcacgaaaaatacgatatttaccctatc
ttcattacaacggaaggggactggataaaagggccgcttttaaccgggcctgttgaaacc
gtgaaacagcttgaattccatgacggaaagaaaatggcccctaatgcgcttttaaccacc
gtatcggacgaaaagggcggctatgacatcatttttccgctgttgcacgggccgaacggg
gaggacggcaccgtacagggcatgcttgaactgttaaatctgccgtatgttggaaatggc
gtgcttgcctcttcagccggaatggataaagtgattatgaaaaacctgtttgcgcaagcc
gggctcgaccaggtgaaatatgtttcttttatccgcagcgaatgggaaaaagcgcccgaa
acctgttttcaacaagtggaagaaaagaccggttacccttgtttcgtcaagccggcgaat
ctcggttcaagtgtcgggatcagtaagtgtaaagaccgcacagaactggaagccgcattt
aaggaagcctttcaatacgaccggaaaatcattgttgaagaaggcgtcacggcaagggaa
attgaacttggcgtgatcgggaatgacgatccgcaatgttccgttgccggcgaaattgtc
gcgaaaaaagatttttacgattataaagcgaaatacgaagatggggatacggcgttaatc
attccggccgaaatttccgaaacggtatataaaaagctaaccgaagctgcgattacggca
tttaaagcactcgactgctcggggctggtgcgcgctgacttttttgtgacagaagacgaa
cgggtgatcatcaatgaaatcaatacgatgcccggatttacgccattcagcatgtttccg
cttctgtggaaagaggcggggctggattacccgcagctgatcgaaaagctgattgaactt
gccctggagcggcatgctgaaaaacagcggattaaatatactttgtaa

DBGET integrated database retrieval system