KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_2334Help
Entry
BF29_2334         CDS       T03712                                 

Gene name
hslO
Definition
(GenBank) 33 kDa chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bcoa03110]
    BF29_2334 (hslO)
Chaperones and folding catalysts [BR:bcoa03110]
 Heat shock proteins
  HSP33
   BF29_2334 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 Bile_Hydr_Trans HTH_17
Motif
Other DBs
NCBI-ProteinID: AJH79331
UniProt: A0A0B5WXL5
LinkDB All DBs
Position
2266648..2267529
Genome map
AA seq 293 aa AA seqDB search
MADYLIKALAYDGQVRAYAADTTETVGEAQRRHYTWPTASAALGRTLTAGAMMGAMLKGD
EKITIKVEGGGPIGVILVDANAHGEVRGYVTNPQTHFDLNKKGKLDVRRAVGTDGTLTVV
KDLGLREHFSGQVPLVSGELGEDFTYYFAASEQVPSAVGVGVLVNPDNTILAAGGFIIQL
MPGTDEKVISEIENKISDTAPISELIREGLSPEEILANLLGKENVQILEKMAVRFECTCS
KEKFASAMIGLGKQELRDMIEEDGQAEAVCHFCRQKYHFSREDLEQMLEEAKG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttggcggattatttaattaaagcattagcgtatgacggacaggtccgggcatacgctgcg
gacacaacggaaaccgttggagaagcgcaacggaggcactacacctggccgacggcttcc
gccgcgctgggcagaacgttaacagcaggggcgatgatgggggccatgctgaagggggat
gaaaaaattacgatcaaagtggaaggcggcggcccgatcggtgtcattctggtagatgcg
aatgcacacggggaagtccggggctatgttaccaatccgcaaacccattttgatttaaac
aaaaaaggaaagctggatgtccggcgtgcagtcgggacagacgggacgcttaccgttgtg
aaagacctcggactgcgcgagcatttttcaggccaggttccgcttgtatccggcgagctt
ggcgaagattttacgtattattttgccgcttccgaacaagtgccatctgcagtcggtgtc
ggggtgctggtcaatcctgacaacacgattctggctgccggcgggtttatcatccagttg
atgccgggaacagacgagaaagtcatctcggaaattgaaaataaaatttccgataccgcg
ccgatttccgaactcatccgcgaggggctttcgccggaagaaatattggcaaatctgctc
ggcaaagaaaatgtgcagatattggagaaaatggcagtacggtttgaatgcacctgctcc
aaagaaaaatttgcttctgccatgatcggcctcggcaaacaggagctccgggacatgatc
gaggaagacggacaagctgaagccgtctgccatttttgccgccaaaaataccatttcagt
cgtgaagatctggaacaaatgcttgaagaagcaaaagggtaa

DBGET integrated database retrieval system