KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_2807Help
Entry
BF29_2807         CDS       T03712                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
bcoa00564  Glycerophospholipid metabolism
bcoa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BF29_2807
Enzymes [BR:bcoa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BF29_2807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8 GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AJH77196
UniProt: A0A0B5WRD9
LinkDB All DBs
Position
2683074..2684702
Genome map
AA seq 542 aa AA seqDB search
MEFSGKQRGTVLQGMKNKTFDLLVIGGGITGAGIALDAVTRGMSVALVEMQDFAAGTSSR
STKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGAFTTNI
GLRLYDFLAGVKKTERRKMLSASETLNKEPLIKKDGLKGGGYYVEYRTDDARLTIEVMKA
AVAHGALAVNYAKAEEYLYENGRICGATVRDQISGETVNVRAKMVVNATGPWSDKMRNKD
GKGSKSLRLTKGVHIVFDQSIFPLRQAVYFDTPDGRMVFAIPRGGKTYVGTTDTFYDKDP
IHPKPLPEDIDYLLKAIRFMFPEVKVTAHDVESSWAGVRPLIYEEGKDASEISRKDEIWE
SESGLVTIAGGKLTGYRKMAETVVDLVARRLGGNFRPCQTKHLPISGGDVGGSEKLPAFV
KAKSKEGEASGLSAEASRAIAEKYGTNADHVYAYAKSWKDDYPLPREVYAVLKYAVEQEM
AVKPVDFFIRRTGALFFDINWVRKWKEPVMTWLAAEFSWDAETEQAYREELEEALREAVP
EV
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaggaaaacagcgcgggacggttttacaaggcatgaaaaataaaacgttc
gatctgcttgtgatcggcggcggcattacaggggccggcattgcgcttgacgcagtgacg
cgcggcatgtcggtagcgcttgtcgagatgcaggatttcgcggcgggcacgtcaagccgg
tcaaccaaacttgtccatgggggcctgcggtacttgaagcagtttgaagtaaagatggtg
gctgaagtcggaaaagagcgcgccatcgtttatgaaaacggcccgcatgtgacaacaccg
gaatggatgctgctgccgttccataagggcggcacgttcggcgcgtttacaacgaatatc
ggcttgcggctgtacgactttttagctggcgtgaaaaaaacggaacgccggaaaatgctg
tcggcttcggaaaccttaaataaggaaccgctgatcaaaaaagacgggctgaaaggcggc
ggttattatgtcgaataccggacggacgacgcgcggctgaccattgaagtcatgaaagca
gctgtcgcacatggggcgctggctgtaaactatgcaaaagcggaagagtatttgtatgaa
aacggccgtatctgcggggccactgttcgtgaccagatcagcggggaaaccgtaaatgtg
cgggcgaaaatggtcgtcaatgcgaccgggccgtggagtgataaaatgcgcaataaggac
gggaaagggagcaaaagcctccgcctcacaaagggcgtgcatattgtgtttgaccaaagc
atcttcccgctccggcaagccgtgtattttgatacgccggatggccgcatggtgtttgcc
attccgcgcggcggcaaaacgtatgtcggcacaacggatacattttacgacaaagacccg
attcacccgaaaccgctcccggaagatattgattacttattgaaagcgatccgctttatg
tttccggaagtcaaagtgacagcccatgatgtcgaatcaagctgggccggcgtccgtccg
ctgatttacgaagaaggaaaagacgcctccgaaatttcgcgtaaagatgaaatttgggaa
tccgaaagcggcctcgtgacaatcgcaggcggcaaactgaccggctaccggaaaatggcg
gaaacggttgtagatcttgtggcgcgcaggcttggcggcaatttccggccgtgccaaacg
aagcacttgccgatttccggcggtgacgtaggcggctctgaaaaattgccggcgtttgtc
aaagcaaaatcaaaagaaggggaagcaagcggcctgtctgctgaagcaagccgggcgatt
gcggaaaaatatggcacgaacgcggatcacgtatatgcatacgcgaaaagctggaaagac
gactatccgctgccgcgggaagtgtacgccgtattgaaatacgcagtggaacaagaaatg
gcggtaaaaccggtcgatttcttcattcgccgtaccggtgcccttttctttgatatcaac
tgggtccgcaaatggaaagagccggtcatgacatggttggccgccgaattttcctgggat
gcggagacagaacaggcgtacagggaagaattggaagaagcattgcgagaagcggtaccg
gaagtataa

DBGET integrated database retrieval system