KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_301Help
Entry
BF29_301          CDS       T03712                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
bcoa00020  Citrate cycle (TCA cycle)
bcoa00310  Lysine degradation
bcoa00380  Tryptophan metabolism
bcoa01100  Metabolic pathways
bcoa01110  Biosynthesis of secondary metabolites
bcoa01120  Microbial metabolism in diverse environments
bcoa01130  Biosynthesis of antibiotics
bcoa01200  Carbon metabolism
Module
bcoa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcoa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BF29_301 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    BF29_301 (sucA)
   00380 Tryptophan metabolism
    BF29_301 (sucA)
Enzymes [BR:bcoa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BF29_301 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJH77696
UniProt: A0A0B5WST8
LinkDB All DBs
Position
306489..309320
Genome map
AA seq 943 aa AA seqDB search
MNATTPKGFWESFSGPNLGYVMDLYEQYLEDPDSIDEEARKVFDQWGAPAVSEGGSLTQG
QADISFQLPANPTIFSKMVAAVKLADNIRTFGHLAADINPLQKPVGDVRRIELGEFDLTE
EDLKKVPASFICPDAPKRVKNGLDAINYLKEVYTQKVAFEFDHIHDMEEKHWLQRTVESG
SFFRELGREQKIGILKRLSDVEGFEKFIHRTFVGQKRFSIEGLDALVPLMEQMIMEAVKT
GVKTVNIGMAHRGRLNVLAHILEKPYELIFAEFKHASNKDLIPSEGSIGITYGWTGDVKY
HLGADRKGQNGGPIGARIVLANNPSHLEVANPVVEGYTRAAQDNRNKAGYPDRDPDRAFA
ILVHGDAAFAGQGIVAETLNMSKLNGYGTGGTIHIIANNNIGFTTETYDSRSTKYASDPA
KGYEVPILHVNADDPEACVQAALFAYAYREKFHKDFVIDLVGYRRYGHNEMDEPMVTNPV
MYHAVHNHPTVRAIYGEQLVKEGVLTAEEVKTIDEAVQKKLQAAYEKVPDGEAEPDTAME
PPENVKKGYLSMKTGVPEQELRAWNAELLAWPENFHVFKKLARILKRREHVFDGKGKIDW
AHAEALAFAAILKDGVPIRFTGQDTQRGTFAQRNLVLHDEQTGEEYIPHHHLSGVQTSFA
IYNSPLTEAGVVGFEYGYNVFSPDTLVIWEAQFGDFANMAQVMFDQFISSGRAKWGQKSG
LVMMLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANVSTAGQYFHILRRQAKWLAKEEI
RPLVLMTPKSLLRHPLASVEPSVLVDGKFHTVLEGPDTENTGAVERILLCSGKVAVDLEE
KLDGADMSWLHTVRVEQIYPFPEQELKEIFARFKNAKEIVWMQEEPENMGSWSFVEPYLR
KLAPQGAEIRYIGRPRRSSPSEGDPVVHKKEQNRILTEAITRP
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaactacaccaaagggattttgggaaagtttttccgggcctaatcttgggtat
gtcatggatttatatgaacaatacctggaagatccggacagcatcgacgaagaggcgaga
aaagtatttgaccagtggggcgcgcccgctgtttccgaaggcgggagcctgacacagggg
caggcggatatttctttccaattgccggcaaacccgacgattttcagcaaaatggtcgct
gctgtcaaattggcggacaatatccggacttttggccatctcgcagcggatatcaacccg
ctccaaaaacctgttggggatgtcagaagaattgaactgggagaatttgatttaaccgaa
gaagatttgaaaaaagtgccggcatcctttatttgcccggatgcacccaaaagggtcaaa
aacgggcttgatgccatcaattatttaaaagaagtgtacacccaaaaagtcgcctttgag
tttgaccatattcatgacatggaagaaaagcactggctgcaacggacagttgaatcggga
agctttttccgcgaactcggccgggaacagaaaatcgggattttaaaacgcctttcagat
gtggaaggatttgaaaaatttattcaccggacatttgtcgggcagaagcgtttttccatt
gaagggcttgatgcgctcgttccgctgatggaacaaatgatcatggaagcggtcaaaacg
ggtgtgaaaaccgttaatatcggcatggcgcacagaggccgcctcaatgtgcttgcccat
attcttgaaaaaccatacgagctcatttttgcggaatttaagcatgcttccaataaagat
ttaatcccttccgaaggatcgatcggcattacgtacggatggaccggcgatgttaaatac
catctcggcgcggacagaaaagggcaaaacggcggcccgatcggcgcgcgtatcgtgctt
gccaacaacccaagccatctggaagttgccaaccctgttgtcgaagggtatacacgtgcc
gcgcaggataaccggaacaaagcgggctatccggaccgcgatccggaccgcgcatttgcg
attcttgtccacggggatgccgcatttgcggggcagggcattgtcgcagaaacgctgaat
atgagcaagctgaacggatacgggacaggcgggaccatccatatcatcgccaataacaat
atcgggtttacgaccgaaacatacgactcgaggtcaacaaaatatgcttctgatccggca
aaaggctatgaagtgccgatcctccatgtgaatgcggatgatccggaagcatgcgtacag
gcggcgctgtttgcttatgcttaccgcgaaaaattccataaagactttgtgatcgacctg
gtcggctaccgccgctacggccataatgaaatggatgaaccgatggtaaccaacccggta
atgtaccatgcggtgcacaatcatccgacggtcagggccatctacggtgaacagcttgta
aaagaaggcgtcctgacagccgaagaggttaaaacgattgatgaagccgttcagaaaaaa
ctgcaggcggcttacgaaaaagtgccagacggcgaagcagaacccgatacggccatggag
cccccagaaaatgtgaaaaaaggctatttgagcatgaaaacaggggtgccggaacaggaa
ctgagggcttggaatgctgaattgctcgcctggcctgaaaacttccacgtctttaaaaaa
ctggcgcggattttgaaacgccgcgaacacgtttttgacggaaaagggaaaattgactgg
gcccatgcggaagcgctcgcgtttgcagccattttaaaagatggcgtgccgatccggttt
accggccaggatacacagcgcggcacgttcgcacagcgcaatctcgtcctgcacgacgaa
cagacgggggaagaatatattccgcaccatcatctatccggcgttcaaacttcatttgcc
atttataacagcccgctgaccgaagccggcgttgtcgggtttgaatacggctataacgtc
ttttcgccggatacgctcgtcatttgggaagcccagttcggcgattttgcaaacatggca
caggtcatgtttgaccagttcatttcatccggcagggcaaaatgggggcaaaaatcaggg
cttgtcatgatgctgccgcacggatacgaagggcaaggccctgaacattcaagcggcagg
gtggaacgcttcctgcaactggcagcggaaaataactggacagtggcgaatgtctcgaca
gccggccaatacttccatattttaagaaggcaggcaaaatggctggcaaaagaagaaatc
cgcccgctcgttctcatgacgccaaaaagcctgcttcgccacccgctggcatctgtagag
ccgtctgtactggtagatggcaaattccacaccgtgctggaaggcccggatacggaaaat
acgggtgcagtcgaaagaatcctgctttgcagcgggaaagtggctgtagacttggaagaa
aagctggacggtgcggatatgagctggctgcatacggtaagggtcgagcaaatttatcct
ttccctgaacaggaattgaaggaaatcttcgcgcgctttaaaaacgcgaaagaaattgta
tggatgcaggaggagccggagaatatgggttcctggtcttttgttgaaccgtatttaaga
aagttggcgcctcagggagcagaaatccgatacatcggccggccgagaaggtcaagcccg
tcggaaggcgacccggtcgtccataaaaaagaacaaaacagaattctgactgaagccatt
acccgcccttaa

DBGET integrated database retrieval system