KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_426Help
Entry
BF29_426          CDS       T03712                                 

Definition
(GenBank) e3 binding domain protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
bcoa00010  Glycolysis / Gluconeogenesis
bcoa00020  Citrate cycle (TCA cycle)
bcoa00620  Pyruvate metabolism
bcoa01100  Metabolic pathways
bcoa01110  Biosynthesis of secondary metabolites
bcoa01120  Microbial metabolism in diverse environments
bcoa01130  Biosynthesis of antibiotics
bcoa01200  Carbon metabolism
Module
bcoa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF29_426
   00020 Citrate cycle (TCA cycle)
    BF29_426
   00620 Pyruvate metabolism
    BF29_426
Enzymes [BR:bcoa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BF29_426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H MurB_C PYNP_C DUF2118
Motif
Other DBs
NCBI-ProteinID: AJH78183
UniProt: A0A0B5X2K3
LinkDB All DBs
Position
430195..431403
Genome map
AA seq 402 aa AA seqDB search
MPVEVIMPKLGMAMKEGTVSQWNKTEGEAVKKGDPIASISSEKIEMEIESPADGSVLKIN
VPEGKGVPPGTVICYIGNPDEEVAATAAPVQEEKGQKEEIQAAHPAPPPKKPGKARVKIS
PVARKMAEASGIKPEDIIGTGPGGRITKEDVEQAIASAKESRKQDIPVQAVAEEPQRIPV
SGMRKVIAERMHLSLQSAAQLTITMKADVTELLALQTQVKETIAKRYGSKLTITDFAARA
AILALENHPEMNSAFMDNTIVTYLEIHLGIATAVEKGLVVPVIRHAESKSLIDLAKEIKE
KAAAARAGKLPADEMQGSTFTISSLGASGVEFFTPILNPPEAGILGVGAVSDEAVFIGDK
IEKRSRLPLSLTFDHRVLDGAPAAAFLQTVKQYLEEPVTMLL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgccggttgaagtcattatgcccaaacttgggatggcaatgaaagaaggaaccgtttca
cagtggaataaaacagaaggagaagccgttaaaaaaggcgacccgatcgccagcatcagt
tcggaaaaaatagaaatggaaatcgagtcccctgcggacggcagtgtattaaaaatcaat
gtgccggaaggaaagggagtgccgccgggaacggtgatttgctatatcggaaatccggat
gaagaagtggcggcaacagcagccccggtgcaggaagaaaaaggccaaaaagaagaaata
caggcggcacatcccgcaccgcccccgaaaaagccgggaaaagcgcgcgtgaaaatttcc
ccggtcgcgcggaaaatggcggaagcatcaggcatcaaaccggaagatataatagggacc
ggcccggggggcaggattacaaaagaagatgtggaacaggccattgcgtcggcaaaagaa
agccgcaaacaggacatccccgtccaggcggtggcagaagaaccgcagcgcataccggta
tccggcatgcgcaaagtgatcgcagaacgcatgcatttaagcctgcaatcggctgcacag
ctgacgatcacgatgaaagcggatgtcacggaactattggcgctgcaaacgcaagtgaaa
gagacaattgcaaaacggtacggcagcaaactgacgatcacggattttgcagcaagggct
gccatccttgccctcgaaaaccatccggaaatgaacagtgcgtttatggataacaccatc
gtcacttacctggaaatccatttgggcattgcaacggcggttgaaaaagggcttgttgtc
ccggtcatccgccatgccgaaagcaaatcgctgatcgatctggcaaaagaaatcaaagaa
aaagcagcggcagcaagagccgggaaacttccggcagatgagatgcaagggtccactttc
accatttcaagcctgggtgcaagcggcgtcgaatttttcacgcctattttgaacccgccg
gaagccgggatattgggtgtcggtgccgtttcggatgaagctgtttttatcggggacaaa
attgaaaaacggagccggctgccgctcagcctgacgtttgaccaccgcgtgctcgacggg
gcgccggcagcagccttcctgcaaacggtcaagcaatatttggaagaaccagttacgatg
cttttgtag

DBGET integrated database retrieval system