KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_839Help
Entry
BF29_839          CDS       T03712                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BF29_839 (ahpF)
Enzymes [BR:bcoa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BF29_839 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored K_oxygenase Thi4 DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_7 Thioredoxin_4 Glutaredoxin NAD_binding_8 FMO-like DUF2190 Nitrate_red_del
Motif
Other DBs
NCBI-ProteinID: AJH79353
UniProt: A0A0B5X5Z6
LinkDB All DBs
Position
complement(810117..811673)
Genome map
AA seq 518 aa AA seqDB search
MILDEEIKAQLAQYLQMMEGDVLLKVSAGSDETSRNMLELVDQLAAMSPRIKVENTKLER
TPSFSVNRPGEDTGIIFAGVPLGHEFTSLVLALLQVSGRPPKVDQKVIDQIQSIKGEYHF
ETYVSLTCQNCPVVVQALNIMSVLSPNITHTMIDGAAFKEEAEGKGIMAVPSIYLNGEFF
ESGRMEVEEILAKLGSTADPSEFEKKDPFDVLVIGGGPSGASAAIYAARKGIRTGIVTER
IGGQVLDTVGIENLIGTKYTEGPQLAANLEEHVKQYNVDIMNLQRAKRVEKKDLVEVELE
NGAVLKSKTVIISTGARWRNINVPGEAEFKNKGVAYCPHCDGPLFAGKHVAVIGGGNSGI
EAAIDLAGVVKHVTVIEFMPELKADRVLLERLYSLPNVTVIKNAQTKEITGTDKVNGITY
IDRATGEEHHIELEGVFVQIGLVPNTEWLGDTVERTPRGEIVVDKRGATSVPGVFAAGDC
TDSAYKQIIISMGSGATAALAAFDYIIRETKTDEAVHN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgatactggatgaagagattaaagcgcaactggcccagtatctgcaaatgatggagggc
gacgttctgctgaaagtgagcgcgggttccgatgaaacatcgcggaatatgctcgaactg
gtcgaccaattggccgccatgtcgccccggataaaagtggaaaacacaaaactcgaaaga
accccgagtttcagtgtaaaccgtccgggagaagacaccgggattatattcgcgggcgtg
ccgctcgggcatgagtttacctcgctcgttttggccctgctgcaggtcagcggccgccct
cctaaagtggatcagaaggtcattgaccagattcaaagcataaaaggcgaataccatttt
gaaacctatgtcagcttgacttgccagaactgtcctgttgtggtacaagccttgaacatc
atgagtgtgctcagtccaaatattacgcacacgatgattgacggggctgcatttaaagag
gaagcggaaggaaaaggcattatggccgtcccttccatttatctgaacggcgaattcttt
gaaagcggccggatggaagtggaagaaattcttgccaagcttggcagcacagcggatccg
tccgagtttgaaaagaaagacccgtttgatgtgctcgtcatcggcggtggcccgtccggt
gcaagtgcagccatttatgcggcacgcaaaggcatccggacagggattgtcactgaacgc
attggcgggcaggtgctcgatacagtcggcattgaaaacctaatcggcacgaagtatacg
gaaggcccgcaacttgctgcaaaccttgaagagcatgtcaaacagtataatgttgatatt
atgaatctgcagcgtgcaaaacgggttgaaaagaaagatctcgttgaggtggaattggaa
aacggggctgtattaaagagtaaaaccgtgatcatctccaccggtgcacgctggcgcaac
atcaacgtgccgggcgaagcagaattcaaaaacaaaggtgtggcatactgcccgcactgt
gacgggccgttgtttgccggtaaacatgttgccgtaatcggcgggggaaactccggcatt
gaagcggccattgaccttgctggtgtggtcaaacatgtaaccgtcattgaatttatgcct
gaattaaaggcggaccgtgtgctgctcgagcgcctttacagccttccgaatgtgacggtt
ataaaaaatgcgcaaacgaaagaaattaccggcacggataaagtgaacggaatcacatat
attgaccgtgcaaccggggaagaacaccatattgaactcgagggcgtgtttgtccaaatc
ggccttgtcccgaataccgaatggcttggcgatacagtggaacggacaccgcggggtgaa
attgtggtggataagcgcggcgcgaccagtgttccgggcgtgtttgccgcaggagactgc
acagacagcgcttataagcaaatcattatttcgatggggtccggcgcgacagctgcgctc
gccgcttttgattacatcatccgggaaacgaaaacggatgaagctgtacacaattaa

DBGET integrated database retrieval system