KEGG   Baudoinia panamericana: BAUCODRAFT_114209Help
Entry
BAUCODRAFT_114209 CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00020  Citrate cycle (TCA cycle)
bcom00190  Oxidative phosphorylation
bcom01100  Metabolic pathways
bcom01110  Biosynthesis of secondary metabolites
bcom01130  Biosynthesis of antibiotics
bcom01200  Carbon metabolism
Module
bcom_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcom_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bcom_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAUCODRAFT_114209
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BAUCODRAFT_114209
Enzymes [BR:bcom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BAUCODRAFT_114209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 19107228
NCBI-ProteinID: XP_007679718
JGI: Bauco1_114209
UniProt: M2MQC3
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MLSSTMRRFAAPRTLARQLQQQRSFSRTTSAQKIITPNGPLRAKEASPFIANKYPVIDHE
YDAIVVGAGGSGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHPDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTEDGRIYQRAFGGQSQDFG
HGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEFFAIDLIMEDGECKGVVAYNQED
GTLHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDMEFVQFHPTGIY
GAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPDK
DHIYLQLSHLPPEILHERLPGISETASIFAGVDVRKQPIPVLPTVHYNMGGIPTKYTGEV
ITVDKEGKDTVVPGLFACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDRFSPGQA
HPEISADAGAESIAAVDHVRTADGPKSTHDIRSAMQKVMQTDVSVFRTQESLDEGVKRIN
DVDASWKQVGTKDRSMIWNSDLVETLELRNLLTCAVQTAEAAANRKESRGAHAREDYPDR
DDKNWMKHTLTWQKEAQAKTEIGYRAVEMNTLDENECKAVPPFARKY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgtcgacaatgcggcgcttcgctgctccacgcaccctcgcccgccagctgcag
caacagcgaagcttctcccgcacaacttccgcacaaaagatcatcacccccaatggacca
ttaagagcgaaggaggcgtcacccttcatcgccaacaaataccctgtcatcgaccatgag
tacgatgccatcgtcgtcggcgccggtggatccgggctgcgagcggcattcggtttggcg
gaggcgggtttcaacacggcatgcatatccaagctttttcctacacgatcacacactgtc
gccgctcagggtggcatcaatgccgctctcggtaacatgcacccggacgactggcggtgg
cacatgtacgatacggtcaagggaagcgattggcttggagaccaggatgccatccattac
atgacgagagaggcgccgcagtctgtcattgagctcgagaactacggctgccccttctca
cgaacagaggacggacgcatctaccaacgtgctttcggtggtcaatcacaggactttggc
catggcggccaggcataccgatgctgcgccgccgcagaccgaaccggccacgctcttctc
cacactctctacggtcaaagcttacggcacaataccaactacttcatcgaattcttcgcc
attgacctgatcatggaggacggtgagtgcaagggtgtcgtagcttacaaccaggaagac
ggcacgctccaccgtttccgtgctcacaacactgtcctcgccaccggcggttacggccgt
gcctacttctcctgcacttccgcacacacttgcaccggtgacggtatggccatggtcgct
cgtgccggtctaccgaaccaggacatggagtttgttcagttccaccctaccggtatctac
ggcgccggctgcctcattaccgaaggctcgcgtggtgagggtggttaccttctcaacagc
gaaggcgaacggttcatggagcgctacgctcccacagccaaggatctcgcctcccgtgac
gtcgtctctcgttctatgactatggagatccgcgaaggccgtggtgtcggccccgacaag
gaccacatctacctgcaactctcccacctgcctcccgagatcctgcacgagcgtctccca
ggtatctccgagacggcctccatcttcgccggtgtcgacgtccgcaagcagcccattccc
gtcctgcccactgtccactacaacatgggcggtatcccaaccaagtacactggcgaagtc
atcaccgtagacaaggagggcaaggacaccgtcgtgcccggcctcttcgcctgcggtgaa
gccgcctgtgtctccgtgcacggcgccaaccgtctcggcgccaactcccttctcgatctt
gtcgtcttcggtcgtgccgtttcacacaccatccgcgaccgcttctcaccaggccaagca
cacccagagatctcggcagatgctggcgcagaatccatcgccgccgtcgaccacgtgcgc
acggcggacggcccgaagagcacccacgatatccgctccgccatgcagaaggtgatgcag
acggatgtgtcggtcttccggacgcaggagtcgctggacgagggtgtcaagcggatcaac
gacgtcgatgcgtcgtggaagcaagtcggcaccaaggaccgcagcatgatctggaacagt
gatcttgtggagacgcttgagctgcggaacctgttgacttgtgccgtgcagacggctgag
gcggcggcgaataggaaggagtcgagaggcgcacacgcccgcgaagattacccagaccgc
gacgacaagaactggatgaagcacacgcttacctggcagaaggaggcgcaggccaagacg
gagattggctaccgcgcggtggagatgaatacgctggatgagaatgagtgtaaggctgtt
ccgccgtttgcgcggaagtactaa

DBGET integrated database retrieval system