KEGG   Baudoinia panamericana: BAUCODRAFT_129421Help
Entry
BAUCODRAFT_129421 CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00290  Valine, leucine and isoleucine biosynthesis
bcom00770  Pantothenate and CoA biosynthesis
bcom01100  Metabolic pathways
bcom01110  Biosynthesis of secondary metabolites
bcom01130  Biosynthesis of antibiotics
bcom01210  2-Oxocarboxylic acid metabolism
bcom01230  Biosynthesis of amino acids
Module
bcom_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bcom_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BAUCODRAFT_129421
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BAUCODRAFT_129421
Enzymes [BR:bcom01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     BAUCODRAFT_129421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-GeneID: 19108201
NCBI-ProteinID: XP_007674166
JGI: Bauco1_129421
UniProt: M2NIH9
LinkDB All DBs
Position
Unknown
AA seq 623 aa AA seqDB search
MLARRIPSVTLRPAWCSRAEWVYAAYRSVSKRVGLTNHLGRRAFSHTTTRCRATPVDDDL
KGLNAVSKHITQPIAQGASQAMLYATGLTETDLQKPQVGISSVWYSGNPCNMHLLQLNHK
VKEGVQKAGLVGMQFNTIGVSDGISMGTKGMRYSLQSRDIIADSIETVMGGQWYDANISI
PGCDKNMPGVVMAMGRVNRPSIMVYGGTVSAGCGVQPRNNKLDIVSAFQAYGQFLSKEIT
EEERSDVIRNAIPGCGACGGMYTANTMASVIEVMGLSLPGSSSNPANSKAKQLECLAAGA
AIRNLLKEDIRPSDILTRRAFENAMILVNITGGSTNAVLHLLAIAHSVGVTLTIDDFQAV
SDRTPFLADLKPSGKYVFEDLYNIGGTPSLIKYLLKEGVLDGSGMTVTGKTLAQNVENAP
DFPSDQDIIRPISNPIKQTGHIQILRGSLAPEGSVGKITGKEGTVFTGKARCFDAEDDFI
TALEANTFQKGEKTVVIIRYEGPRGGPGMPEMLKPSSAIMGAGLGNDIALITDGRFSGGS
HGFLIGHVTPEAQAGGPIGLVRDGDTICIDADKRVIDIVDQSDEELQRRKLEFKAPPLKY
QRGTLYKYAKNVMDASHGCITDA
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccagaaggataccctctgtcacgctgcgcccagcgtggtgctcgcgggcagaa
tgggtgtatgccgcatatcgatccgtgtcgaaaagggttggcttgactaaccatctcggt
agacgagctttctcgcatacgaccactcgttgccgcgcgacccccgtggacgacgatctc
aaaggcctcaatgcggtctcgaaacacatcacccagccgatcgcgcaaggcgcctctcaa
gccatgctatacgccaccggtctcacggaaacagacctacagaagccgcaggtcggcatc
tcgtcagtatggtactctggaaatccctgcaatatgcacctactgcagctcaaccacaaa
gtcaaggaaggcgtgcagaaggctggcctggtaggcatgcagttcaacaccatcggcgtg
agcgacggcatcagtatgggcacgaaaggcatgaggtacagtctgcagtcacgagatatc
attgcagacagcatagaaactgtaatgggtggacagtggtacgatgcgaacatcagtatt
ccaggctgcgacaagaacatgcccggagttgtgatggcaatgggacgagtgaaccgtccc
tccatcatggtgtatggtggtacagtatcagcaggatgcggtgtgcaaccacgcaacaac
aagcttgatattgtctcggccttccaggcatacgggcagttcctctcgaaggaaataacg
gaggaagaacgatcggacgtgattcgcaacgccatcccaggctgtggtgcctgcggcggc
atgtatacagccaacactatggcgtctgtgatagaggtcatgggtctgagcttgcctggc
tcctcttctaatccagctaacagcaaggccaagcaactggagtgcttagccgcaggcgca
gccattcggaacttgctgaaggaagacatcaggccgtccgacatccttacccgaagagcc
ttcgagaatgccatgatcctcgtgaacattactggtggcagtaccaacgccgtcctacat
ctgctcgccattgctcacagtgtcggtgtcaccttgactatcgatgacttccaagctgtc
tctgatcggacacccttccttgccgacctcaagccatccggaaagtacgtcttcgaagac
ctgtacaatatcggcggtacaccctcactcatcaagtacctcctgaaggaaggcgtgttg
gacgggtcaggcatgacggtcaccggcaagacgctcgcgcagaacgtggagaatgcacca
gacttcccttctgaccaggacatcattcgaccaatttcaaacccaatcaaacagaccggc
catattcagatcctgcgcggctcgctggctcctgaaggctctgttggaaagatcactggc
aaagaaggcaccgtctttaccggcaaagcgcgctgcttcgacgcggaagatgacttcatt
accgctcttgaagcgaacactttccagaagggtgagaaaacggtcgtcattatccgctat
gaaggtccacgaggcggtcccggtatgccggagatgctcaaaccctcctccgccattatg
ggcgctggtctcggtaatgacattgcgctcatcacggatggtcgattcagtggcgggtcg
cacggcttcttgatcggtcacgtcactccggaagcgcaggcgggtgggccgattggtttg
gtgcgtgacggcgacacgatctgcatagacgctgataagcgtgtcatcgacatcgttgat
caaagcgacgaggagttgcaaagacgcaagctagagttcaaggcgccgccgctgaagtac
cagagaggtaccctgtacaagtacgcgaagaatgtgatggacgccagccatgggtgcatt
accgatgcgtaa

DBGET integrated database retrieval system