KEGG   Baudoinia panamericana: BAUCODRAFT_137709Help
Entry
BAUCODRAFT_137709 CDS       T03106                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00052  Galactose metabolism
bcom00500  Starch and sucrose metabolism
bcom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BAUCODRAFT_137709
   00500 Starch and sucrose metabolism
    BAUCODRAFT_137709
Enzymes [BR:bcom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     BAUCODRAFT_137709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N CBM_20 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 19108338
NCBI-ProteinID: XP_007674777
JGI: Bauco1_137709
UniProt: M2MMF5
LinkDB All DBs
Position
Unknown
AA seq 1016 aa AA seqDB search
MAALVKRLLLATLTIASFSAANPVPALLERQGSNSTSVLAACPGYKASHIQHTENGLTAT
LTLAGTACNAYGTDLTDLTLTVEYQTDQRLHVKIQDAANQVYQVPSSVFERPASSSGCSQ
SSSDLIFRHKNNPFSFTVTRRSNGEVLFDTSAASLVFESQYLRLRTNLPENPSLYGLGEH
TDPFMLNTTNYTRTIWNRDAYEVPPGTNLYGDHPVYFDHRGANGTHGVFLLNSNGMNIVI
DNTNGQYLEYNTIGGILDFYFMSGPSPVQVAQQYSEVVGKSAMMPYWGFGFHQCRYGMQD
VYEVAEVVANYSQAGIPLETMWTDIDYMYLRRVFTLDPDRFPLDLVQQLVTYLHTHQQHY
IVMVDPAVAYQDYPAFNDGVSANAFLTVGNGSVYKGVVWPGVTAFPDWFAPGTQGYWDGQ
FDSFFDPTTGVDIDALWIDMNEASNFCVYPCADPEGQAASMGDPPRPPAVRLGAPRPIPG
FPADFQPQCKAEVTFNVNASTFFGENIAVFGSAVTIGSGDDTMNAVGLGTANYPIWSATI
DMPANTVVTYQYLRAEPGGTYIFEASNRTLTTGGCNSTQSTNDTITTTSPPGSSKMFKRD
ATPVAHGAPVVARQASGTETGLPGRNLIDPEYTINNVAGSLSNKTLDTDLVHYGGWVEYD
THNLYGAMMSEASRLAMLSRRPTVRPMVITRSTFAGSGRQVGHWLGDNAADWSHYLISIA
ELLEFGALFQLPMVGSDVCGYAGNTNELLCARWATLGAFSPFYRNHGEQGALPHEFYRWP
LVAEAARNAIATRYQLLDYFYTAFYEQNQTGTPSVQPMFFVYPEDGNTNALQYQYFFGPA
IMVAPVTDENSTTAEIYMPNDVFYDFYTHEQVQGTGSMVTLDNVPYTTIPLYYKGGSIVA
LRAKSTNTTTELRNQDFSIVIAPSQNGTASGALYLDDGNSLVQTATSYITFTYSRDSLVI
GGSFGYQTNVSISSITVLGGPSSSNANTSSNVVTSQKSKMQTTNIPLTGPRSIQVS
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctcgtcaagcgcttgctgctcgctacactcactatagcatccttctcagcc
gcgaatccagtgcctgcgctgcttgaacgtcagggcagcaacagcacctcagtcttagca
gcctgtcctggctacaaagcgagccacatccagcacacagagaatggcttgactgcaacg
cttaccttggctggcactgcgtgcaacgcctacggcacggatcttacagacctgaccttg
acggttgagtaccagacagaccagcgacttcacgtcaagatacaggacgctgcaaatcaa
gtctaccaagtgccttcttcagttttcgagcgcccggcttcgtcttctggctgtagccag
tccagctcagatctcatcttcaggcacaaaaacaatcctttcagcttcacggtaactcgg
cgcagcaatggagaggtccttttcgacacctcagccgctagccttgtctttgagtcgcaa
tatcttcgtctgcgtaccaacctaccagagaacccgagcttgtacggtctcggtgagcac
accgacccgttcatgctcaatacgaccaactacacgaggaccatctggaaccgcgatgcg
tacgaggttccgcctggcactaatctatatggtgatcaccctgtctactttgaccatcgt
ggcgccaatggtacacatggggtcttcctgctcaactcaaatggcatgaatattgtcata
gacaacacaaacggacaatacctggagtacaataccatcggtggcatcctcgacttctac
ttcatgagcggcccatcgccagtgcaagtagctcagcaatactccgaagtggttgggaag
tcggccatgatgccgtattggggcttcggcttccaccaatgccggtatggcatgcaggac
gtctacgaggttgctgaggtggttgcaaactattcccaggctggcattccgcttgagacg
atgtggacagatatcgattacatgtatctgcgtcgcgtcttcactctagaccctgaccga
ttcccgctcgacctcgtgcagcagctcgtcacctatttgcacacccatcagcagcactac
attgttatggtcgatccggccgttgcgtaccaggactacccagccttcaacgacggtgtt
agtgccaatgccttcctcacggtaggcaacggatccgtgtacaaaggtgtggtctggcct
ggtgtgacggccttcccagattggttcgctccaggcactcaaggctactgggacggtcag
ttcgactctttcttcgatccaactacgggcgtggatattgatgcattgtggatcgacatg
aatgaggcttcgaacttctgcgtgtatccttgcgccgacccggaagggcaagctgcgagc
atgggagatccgccacggccaccagcagtcagattgggtgctccgaggccaatacccggc
ttcccagccgacttccagcctcaatgcaaggccgaagtgacattcaacgtcaatgctagc
acattctttggtgagaacattgctgtgtttggctccgcggttaccatcggtagcggcgac
gataccatgaatgccgtgggcttgggtactgcgaactatccaatttggagtgctaccatt
gacatgccggccaatactgttgttacctaccagtacctgcgggctgagccgggcggaacc
tacatcttcgaggcttccaaccggacccttaccaccggagggtgcaattccacgcaatct
acgaacgacaccatcaccacaacttctccgcctggctcttcgaagatgtttaagcgtgat
gctactccggttgcacacggcgcgcctgtggtagcaaggcaagcttctggtaccgagacc
ggtttaccaggacgtaatctgatcgatccagagtacacgatcaataatgtcgccggcagt
ctcagcaataagacgctcgataccgacctcgtgcattatggaggctgggtggagtacgat
acgcacaatctctacggtgccatgatgtccgaggcctcgcgtctggcgatgcttagtcgt
cgacccaccgtaaggcctatggttattacacgctcaacatttgctggatcaggcagacag
gttggccactggcttggcgacaatgcggcggattggtcgcactatctcatctcgatcgcc
gagctgctggagtttggtgcgctgttccagctgcctatggtcggcagcgatgtctgtggc
tatgcaggcaacacgaacgaactgctctgcgctcgttgggcgactcttggcgctttctcc
ccgttctatcgcaaccacggcgagcagggcgctctaccacacgagttctaccgctggccg
ctcgtcgccgaagccgctcgcaacgccattgctacacgttaccagctcctcgactacttc
tacactgccttctacgagcagaatcagactggtacgccatctgtacagccaatgttcttc
gtctacccggaggacgggaatacaaatgcactgcaataccaatacttttttggcccagcc
atcatggtcgcacctgtgactgatgagaacagcacaacagcggaaatctacatgccaaat
gatgtcttctacgacttctacacgcatgagcaggtccaagggactggtagcatggtcaca
cttgacaacgtgccttacaccacgatcccactctactacaaaggtggcagcattgtcgcc
ctccgcgcaaaatccaccaacaccaccaccgagcttaggaatcaagatttcagcatcgtc
atcgcaccgtctcagaacggaaccgcttccggggctctgtacctcgacgacggcaatagc
ctcgtgcaaacagctacgagctacatcacgtttacgtacagccgtgacagcttggtgatc
ggtggtagctttggctaccagacgaatgtatccatcagcagcattacggtcctgggcggc
ccaagcagctccaatgcaaacacgagcagtaacgtggttacgtcgcagaaatcgaagatg
cagacgacgaatatacctctgacgggcccgcgcagcattcaggttagctga

DBGET integrated database retrieval system