KEGG   Baudoinia panamericana: BAUCODRAFT_26548Help
Entry
BAUCODRAFT_26548  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00020  Citrate cycle (TCA cycle)
bcom00190  Oxidative phosphorylation
bcom01100  Metabolic pathways
bcom01110  Biosynthesis of secondary metabolites
bcom01130  Biosynthesis of antibiotics
bcom01200  Carbon metabolism
Module
bcom_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcom_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bcom_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAUCODRAFT_26548
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BAUCODRAFT_26548
Enzymes [BR:bcom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BAUCODRAFT_26548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 19110448
NCBI-ProteinID: XP_007679136
JGI: Bauco1_26548
UniProt: M2N2L8
LinkDB All DBs
Position
Unknown
AA seq 674 aa AA seqDB search
MAWPLSRAWVDAATVLGRLPHMPQFQYNTRIAGRRMPTSLPLSQRRGLLGQAQRRRATTA
AASPIDHSLIDHHYDAIVVGAGGAGLRAAVGLAESGLETACITKLFPTRSHTVAAQGGIN
AALGNMTKDDWRWHMYDTVKGSDWLGDQDAIHYMCREAANTVYELENYGMPFSRTEDGRI
YQRALGGQSLEYGKGGQAYRCCAAADRTGHAMLHTLYGQSVKCGHDCSRADDVKHNTNFF
IEFFCLDLLMVDGACVGVLCMSMEDGKLHRIFARNTVLATGGYGRAYFSCTSAHTSTGDG
NAMVARAGLPNQDFEFVQFHPSGIYGAGVLITEGARGEGGYLLNSQGERFMERYAPTAKD
LASRDVVARSMNIEIRDGRGCGPDKDHIYLQLSHLPKELIYERLPGIAETASVFAGIDIT
KEPIPVLPTVHYCMGGVPTNFKGQVLNVDPVTGSEKTVKGLYAAGEVASVSVHGANRLGA
NSLLDIVVFGRACAMDIAANNERGMDHKAAPQNIGYDSLAEMEAIRKSDGDTSGAQLRTD
MQKVMQADIAVFRTKDSLEVGNKRLAQIQHDFKNRIAVKDKSLIWNSDLIETLELRNLLT
CAAQTAKSAVARKESRGSHAREDFPDRLDGEWMKHSLTWQRGEGDDVTVGYRKVTGSTLD
EEECKAVPPVMRSY
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcctctatcacgagcttgggtcgacgcagcaactgtccttggtcgcctgccg
catatgccgcagttccagtacaacacaaggatagccggacgccggatgcccactagttta
cctcttagccagcgacgaggcttgctgggccaagctcagcgtcgacgagctactactgca
gctgcttcgccgatcgaccattctctgatcgaccaccactacgatgccattgtcgtagga
gctggaggcgcaggcctccgtgcagcagtcggtctcgccgagtccggtctggaaactgcc
tgtattacgaagctcttcccaacccgctctcacaccgtcgccgcgcaaggcggtatcaac
gctgccctgggtaacatgacaaaggatgactggcgctggcacatgtacgatacagtgaaa
gggtcagactggttaggcgatcaagatgcgatacactacatgtgcagggaggcagctaat
acagtctatgagctagagaattatgggatgccattttcgaggacggaggatggcaggata
taccagcgtgcattgggcgggcagagtctggagtatgggaagggagggcaggcttataga
tgctgtgccgcggctgaccgcaccggtcacgcaatgttgcatacgctgtatgggcagagt
gttaagtgcggacatgactgctctcgtgctgacgatgtcaagcacaatacaaacttcttc
atcgagttcttctgcttagaccttctcatggtggacggagcgtgcgttggcgtgctgtgc
atgtcaatggaagacggcaaattgcatagaatctttgcgcgcaatacagtgctggccacg
ggcggttatggacgagcgtacttctcgtgcacttcggcacatacgtccaccggagatggc
aacgcaatggtcgctcgagccggtcttccaaaccaagacttcgagtttgtccaattccac
ccatccggtatctacggagctggcgtacttatcacagaaggtgcgagaggcgaaggtggg
tacctactgaactcgcaaggcgagcgtttcatggaacgatacgcgcccacggcaaaggat
ctggcttcgcgagacgtcgtggcgcggagcatgaacatcgagatccgcgacggccgtgga
tgcggaccggacaaggaccacatctacctccagctgagccacttgccgaaagagctgata
tatgaacgcttacctggcattgcggaaacggcatcagtgtttgcgggtattgatatcacg
aaggagccgattccggtgcttccgactgtgcattactgcatgggtggtgtgccgacgaac
tttaaaggacaagtattgaatgtcgatcctgtcactggtagtgagaagacggtcaaggga
ctatacgctgcgggagaggtggcgtctgtgagtgtgcatggtgcgaaccggctgggtgcc
aacagcttgctggatattgtggtgttcggccgggcgtgcgcaatggatatcgcggccaac
aacgagcgaggtatggaccacaaagcggccccacagaatattgggtacgacagcctggca
gagatggaagcgatccgcaaatcagacggcgatacatcaggcgcccagttacggacggac
atgcagaaagtgatgcaagccgacatcgccgtattccgtaccaaagacagcttagaagta
ggcaacaagcgcctggcacagatccaacacgactttaagaaccggatagcggtgaaggat
aaaagcttgatctggaactccgacctcatagagacgctggagctgcgaaacctcctcact
tgtgcggcgcagacggcgaagagtgcggtggcgcggaaagagagtcggggcagtcatgcg
agagaagactttccggaccggctcgacggcgagtggatgaagcatagcttgacgtggcag
cgtggagaaggggatgatgttacggttgggtataggaaggtgacgggttcgacacttgat
gaagaggagtgtaaggcagtgccgccggttatgagaagctactga

DBGET integrated database retrieval system