KEGG   Baudoinia panamericana: BAUCODRAFT_38406Help
Entry
BAUCODRAFT_38406  CDS       T03106                                 

Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00500  Starch and sucrose metabolism
bcom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BAUCODRAFT_38406
Enzymes [BR:bcom01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BAUCODRAFT_38406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 19113528
NCBI-ProteinID: XP_007680396
JGI: Bauco1_38406
UniProt: M2M7Q1
LinkDB All DBs
Position
Unknown
AA seq 670 aa AA seqDB search
MRPKPSSTWYLISLSLVVAICTVTFYLSSSDLAIISVARMRSALASILAGTTFAATTLGQ
ACQTTTLTSSAPTDGSELALQSYSYCGGTLNATVYIANLDYNKVVSLYYTNAQGLSTPLS
VVTFGYSSSIANNFELWTTSTPVYIDGITTLLNLTYQATDIGETYVQTLNLPVNASGAPA
PSVAAPPKPYATPRGFGGDITTWLSVNTSSESETAFRRMFLNINPAIPGAAEGVVVAARS
GPSYTQTDPDYEYNWVRDASLTMDVVQTLYASATKKVTKLQYEDILFQYATARATEQNDP
GLQTGLGEPKFYLNNTIFSGPWGRPQNDGPATSAITLMEFATSYLANGGSMNVVQSNIYD
SATFPTTAPVKKDLLFVASNWSSSSFDLWEEEESDHFYTRMVQRRALVMGAAFANTMGDS
STSATLSAAATALTATLSQFWDPNRQILLYEYGPVLHDKSSYLDIAVILGVIHGYAADNV
YSYSSDQIMASALRISTSFLNVFPIANTTMDSNGLVLGIPIGRYPEDVYNGTGTAANGGN
PWYLCTAAMSQYMYSLSSTFGAAQAITVTNVSKPFFDYFAPQAGLQTGETYTYGTQKYNQ
AIGGINGWGDAFMRTVKYYTPADGRLAEEFNRNTVGSVLAFMIDCEDGLTVFYRAYRKAR
RISRGRMPVC
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccgaaaccgtcctctacttggtacctcatctctctctctcttgttgttgcgatt
tgcaccgtcactttctacctctcctcatcggacttagccatcatcagcgtagcgaggatg
cggtcagcacttgccagcatccttgccggtactacgtttgcggctacaactcttggccag
gcatgtcaaaccaccacacttacttcaagtgctccgaccgatggttctgagctggctttg
cagagctacagctattgtggcgggacactgaacgccacagtctacattgccaaccttgac
tataacaaggtcgttagtctctactacaccaacgcgcaaggtctaagcacaccgttgtcc
gtggtcacgttcggctactccagcagcatcgcgaacaatttcgagctctggacgacaagc
acgcccgtctacatcgatggcatcaccactttactcaacctcacctaccaggccacggac
attggagagacgtatgtacagaccctcaacttgcccgtcaatgctagcggagcgccggcc
cctagtgttgctgctccaccaaagccatacgctacccctcgaggttttggtggtgacatt
actacatggctttcggttaacaccagctcggagtcggagactgcttttcggcgaatgttc
cttaacatcaatcccgcgatccctggtgcagccgaaggtgtggtcgttgccgcccgtagc
ggaccttcatacacgcagaccgatcccgattacgagtacaactgggtgagggatgccagc
ttgaccatggacgttgtccagacactctacgcctccgccacgaaaaaggtgacgaagctt
caatacgaggacatcctcttccagtacgccaccgccagagcaacggaacaaaacgatccc
ggtctgcaaaccggcctcggtgagcccaaattctacctcaacaacaccatcttcagcggc
ccttggggacggccgcagaatgacggcccggccacatctgccataacgctcatggagttc
gccacttcctacctggccaatggcggcagcatgaacgtggtccaaagcaacatctatgac
tccgccaccttccccaccacagcacctgtgaagaaagacctcctcttcgtggcctcaaac
tggtcctcgtcctccttcgatctctgggaggaggaagaaagcgaccacttctatacccgc
atggtgcagcgtcgcgccctcgtaatgggcgccgctttcgccaacaccatgggcgacagc
agcacttccgccaccctctccgccgccgcaacagcactaaccgccaccctctcccaattc
tgggacccgaaccgccaaatcctgctctacgaatatggtccggttctgcacgacaaatcc
agctacctcgacatcgccgtcattctcggcgtcatccatggctacgcagccgacaatgtt
tactcctactccagcgaccaaatcatggcgtctgccttacgcatctctacctcattcctc
aacgtctttccgatcgcgaatacaaccatggactctaacggactcgtcctcgggattccc
atcggtcgctacccagaagacgtctacaacggcaccggcaccgccgcgaacggcgggaac
ccatggtacctctgcacggcggcaatgagccagtacatgtactcgctttccagcaccttc
ggcgcagcccaagcgatcacagtcacgaacgtgtcaaagcctttcttcgactacttcgcg
ccgcaagctggattgcaaacgggcgagacgtacacgtacggcacgcagaagtacaatcaa
gctataggtggtatcaatggttggggcgatgcgttcatgaggactgtcaagtactatact
cctgctgatgggcggttggccgaagagttcaaccggaatacggtaggttccgtgttggcg
tttatgattgattgtgaggatgggctgacagtgttttacagggcgtaccgcaaggcgcgg
cggatctcacgtggtcgtatgccagtgtgctga

DBGET integrated database retrieval system