KEGG   Baudoinia panamericana: BAUCODRAFT_426065Help
Entry
BAUCODRAFT_426065 CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
Organism
bcom  Baudoinia panamericana
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NAD_binding_7 2-Hacid_dh_C adh_short AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-GeneID: 19114210
NCBI-ProteinID: XP_007675051
JGI: Bauco1_426065
UniProt: M2NGJ1
LinkDB All DBs
Position
Unknown
AA seq 371 aa AA seqDB search
MLAARYYGKEDVRIVNDIQRPKCGAGQVKVEPAFVGICGTDLHEFMGGPNFSPTSPHPIT
KEAIPITIGHEFSGTIKELGSGLEHSGLKIGQRLAVQPTIYCAQCGACSVGAENACLNGG
FIGLSGGGGGISEEVVVPAEACLPLPDNVGLDIGALVEPLAVAWHAVDASPIAEIKEPKC
VVFGGGPIGLAVVQVLRARGAKLIICVEVAKRRQEFASEFGADHVLDPTKHDVVSTALEL
CGGMHPPDLAFDCAGVPQSLETACKVIRSRGTVVNVAIWEHAISFNPNWLVFREANYKAV
LGYQRKDFKGVIEALGEGKIKPAKMITSRIQMDKLVDDGYWALIKEKDKHVKILVDVKAG
VSDPASIVKST
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgctagccgctcgatactacgggaaagaagatgttcgcatcgtcaacgatattcagcga
ccgaaatgcggcgcagggcaggtgaaggttgaacctgcattcgtcggcatttgcggaaca
gatctacatgagtttatgggaggtccgaacttctccccaacatctccccatcctatcaca
aaagaagcgatacccatcaccatcgggcatgagttctccggcaccatcaaggagctgggg
agcggtcttgagcattcaggcttgaagattggtcagagattggccgtccaacccacaatc
tactgcgcacaatgcggtgcttgttcagtcggagcggagaatgcttgtctcaacggcggc
ttcattggtctgtccggtggcggtggtggcattagcgaagaggtggtggtgcctgccgaa
gcatgcctaccactgcccgacaatgttgggctcgacatcggcgcccttgtggagccactc
gcagttgcctggcatgccgtcgacgcttcgccaatcgcagagattaaggagccgaaatgc
gtggttttcggtggtggaccgatcggtctggcagtcgtgcaagtactgcgtgcaagaggg
gccaagcttatcatctgcgtggaggtcgctaagagacgtcaagaatttgcaagtgagttc
ggcgcggaccacgtactggatccgacgaagcatgatgttgtctctactgcgttggagttg
tgcggtggaatgcatcctccagatctcgccttcgactgcgccggcgtcccgcaatctctg
gaaaccgcatgcaaagtcataagaagccgtggaacagtcgtcaacgtcgctatatgggag
catgcgataagtttcaatccgaactggctcgttttccgcgaggccaactacaaagctgtc
cttggatatcagagaaaagacttcaagggtgtcatcgaggcgctcggcgaaggcaagatc
aagccggcgaaaatgatcaccagtcgaatacagatggacaagctcgtggacgatggatac
tgggcgttgatcaaagagaaggataagcatgttaagatactggttgatgtcaaggccggt
gtctccgatccagcaagcattgtcaagtcaacgtga

DBGET integrated database retrieval system