KEGG   Baudoinia panamericana: BAUCODRAFT_62112Help
Entry
BAUCODRAFT_62112  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
Organism
bcom  Baudoinia panamericana
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C_3 GST_C Glutaredoxin HsdM_N
Motif
Other DBs
NCBI-GeneID: 19115971
NCBI-ProteinID: XP_007672261
JGI: Bauco1_62112
UniProt: M2MVT0
LinkDB All DBs
Position
Unknown
AA seq 281 aa AA seqDB search
MSQTDGAQQNGHASKAELDANQGGNHNKKTYHKQATGLAWETVQAHSSDNDLKLYGSCFC
PFVHRVWISLEHKGLDYQYVEVDVYRKPKLLLDINPRGLVPALRHGDWGCYESTVLMEYL
EDLHQGKPLLPKDPKQRAESRLWSDHINRHIIPLFYRYLQAQDANDQASYAKELTEQIAK
LVSAADSNGPFFLGSKLTFVDVQMAPWVIRLEKVLKPYRGWPDPEPGSRWEKWVRAIEAN
DAVKKTTSDDDLYLDSYERYAENRPNTSQVQAAINNGSGMP
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaacagacggcgcgcaacaaaacgggcacgcttcgaaagccgagcttgatgcc
aatcaaggcggcaaccacaataagaagacctaccacaagcaagccaccggcctcgcgtgg
gagacggtgcaagcccactcatccgacaacgacctcaagctctatggatcatgcttctgt
cccttcgtccaccgtgtctggatctcacttgagcacaaaggcctggattaccagtacgtc
gaagtggatgtctaccgcaagcctaagctcctcctggacatcaatcctcgtggcttagta
cccgccctacggcacggtgactggggctgctacgaaagcaccgtactgatggagtatctc
gaggacctgcaccaaggcaagcccttgctacccaaggatccaaagcagcgagccgagagt
agactctggagcgaccacatcaaccgccacatcatcccgctcttctaccgctaccttcaa
gcccaggacgccaatgaccaagccagttacgccaaagaactcacagagcagatcgcgaag
ctcgtctctgccgcagactccaatggtcccttcttcctcggctccaagttgacattcgtg
gacgtgcagatggcaccttgggttattcggctcgagaaagtgctgaagccttaccgcggt
tggccggacccagagccgggaagcaggtgggagaagtgggtaagggcgattgaggcgaac
gatgcggtcaagaagactactagtgacgatgacttatatctggattcgtacgagcggtat
gcggagaatcggccgaacacgagtcaagtgcaggcagccattaacaatggaagcggaatg
ccgtga

DBGET integrated database retrieval system