KEGG   Baudoinia panamericana: BAUCODRAFT_76228Help
Entry
BAUCODRAFT_76228  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
bcom  Baudoinia panamericana
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bcom03036]
    BAUCODRAFT_76228
Enzymes [BR:bcom01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     BAUCODRAFT_76228
Chromosome and associated proteins [BR:bcom03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     BAUCODRAFT_76228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 19117005
NCBI-ProteinID: XP_007679386
JGI: Bauco1_76228
UniProt: M2MAH5
LinkDB All DBs
Position
Unknown
AA seq 962 aa AA seqDB search
MSSPVSPAPPTPHMTTPRRPSHPATSPLQQTSTFPQPPTLRRASSNMSLGQRPTPSPKLV
RKSSRQSMTGQTEESEKRPTPKRSISNLIANLREAQATMESIDEPVPLTAAQLATAHFTQ
ELLAHTQPDVHAETVVILHDACYAHRYSRLKATKSTLSMIVERPERIHASVLGASAAYVR
LGEHYAGARNAPHPHRQQASPPPFKIRRTTRSVDIGSTYVTNVHGTAWMSELRELCNAAG
DRLATGAKELERAATPNGQDKRKLHEGDLYLAPESLDAFQGALGGVADAVDAVFEPATPT
KRAFVAIRPPGHHCSADYPSGFCWLNNVHVGIEYAAQTHGLTHAAILDFDLHHGDGSQAI
TWERNSKNNQKRLYPKPNSKARLGPDIGYYSLHDINSYPCEMGDDDKVQAASLCIENAHG
QSIWNVHLQEWKTEEEFWRLYEGRYRMLLEKARDFLRHHTLRLHGEGRVPPKATVFISAG
FDASEWEGAGMQRHKVNVPSEFYARFTRDVVELAQEEGTSCEGRVISVLEGGYSDRALCS
GVLSHLSGLCASPPLPTHGMNTKDSASLDEMMNGLRIHGQTSSSPTTLSYDKTWWSPANL
TALELKINPPLPPLQPKRVRTGPQPTYATPTESFAYKVVDPNKFARSISGTMREMPPPPP
RPRTPPPPEVDWVVATQELSRLLIPTDRRTRSWTAEELGAGRTKKERQSAAPVLEGTGAS
ASVDDAVGKPRQLRERKGKVLGAGAGAYVESAYSDGVESVRSVSRGSSSRRQTMHELPLT
TNGGVNEEQQPLVRRVSRRLSGGSALSGVSDGLVSIDADPPPIPAVPVPTFAPAAMTNGN
MRPPAVPALTGNGGAMQVKKTRAPPAAAKPKKPAGQAQHVPVPTSAPEPSPAANGGTVVN
DLHELTSGLKRISLKVGSREEHDRKLKEKERDVAAAAAAERSARAKRAAETRRVNAAARK
AA
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcccgtgtcgcccgcacccccaacacctcacatgactacgcctcgccgaccg
tctcacccagcgacctctccgctccaacaaaccagcaccttcccgcaaccgcccactctc
cgaagagcttccagcaacatgagcctcggacagcgaccaaccccttcacccaagctggtc
cgcaaaagctcgagacagtcaatgaccggtcagactgaggagtcggagaagcggccgaca
ccgaagcgatccatctccaacctcattgcgaatcttagggaggcgcaagcgacgatggag
tcgatcgatgagcccgtcccgctcaccgccgcccagctagccaccgcccacttcacgcaa
gagctcttggcgcacactcaacctgatgtccatgcggaaacggtggtgatcttacacgac
gcatgctacgcccaccgatactcccgcctgaaagcgacaaagtccacattatcgatgatc
gtagagcggccggagcgcatccatgcgagcgtattgggtgcgtcggcagcgtatgtgagg
ctcggcgagcattatgcgggagcacgaaacgcaccacacccgcaccgacagcaagcatct
ccaccacccttcaaaatcaggcgaacgacgcgctccgttgacattggcagcacgtatgta
acgaacgtgcacggcacggcatggatgtcggagctgcgggaactgtgcaacgcggcaggc
gatcgactggcaacgggcgcgaaggagctggaacgagctgccaccccaaacggtcaggac
aagcgcaagctccacgaaggggacctctacctcgctcccgagtcgttagatgcatttcag
ggcgcactgggaggtgtggcagatgccgtcgacgctgtcttcgaacccgcaacgccgacc
aagcgtgctttcgtcgccattcgtccgccgggtcatcactgttccgccgactacccttct
ggattctgctggctcaataacgtgcatgtcggcatcgaatatgcggcgcagacgcacggc
ctcactcatgccgcaatcttggacttcgacttgcatcacggcgacggcagccaagccatc
acctgggagcgcaacagcaagaacaatcagaaacgtttgtatcccaaacccaacagcaaa
gccagactaggtccggatatcgggtactacagcttgcatgatataaatagctacccctgc
gagatgggcgatgatgacaaagtccaagcagccagtttgtgcattgagaacgcgcatggg
cagagcatctggaatgtgcatttacaggagtggaagacggaggaggagttttggagattg
tatgaaggccggtatcgtatgttgcttgagaaagcgagggatttcttgcgccatcacacc
ctgcggctacacggagaaggcagagtaccaccgaaagcgacggtgttcatcagtgcagga
ttcgacgcaagtgagtgggaaggggcgggtatgcagaggcacaaggtcaacgtgcccagc
gagttctatgcgcgcttcacacgtgatgtcgtggagcttgcacaggaagaaggcacgagc
tgtgaggggagggtgatcagtgtgctagaaggcggctacagcgatcgagcgctctgcagc
ggcgtactgagccatctctccggcctctgcgcctccccacccctacccacccacggcatg
aacacgaaggacagcgcaagcctggacgagatgatgaacggcctgcgcattcacggccaa
acatcatcctccccaaccaccctctcctacgacaaaacctggtggtcccctgccaaccta
accgccctagaactcaaaatcaacccacccctacctcctcttcaacccaaacgagtccgc
acaggcccccaaccaacctacgccacacccaccgaatccttcgcctacaaagtcgtcgac
ccgaataaattcgcccgctcaatctccggcaccatgcgcgaaatgccgccgcctccgcct
cgaccacgcaccccgccgcctccggaggttgattgggtcgttgcgacgcaggagttaagt
cgactgctcatacctactgatcgacgaacgaggagttggacggcggaggaattgggggca
gggaggacgaagaaggaacggcagagcgctgcgcctgtgcttgagggtacgggtgcgagt
gcgagtgtggacgatgctgttgggaagccgcggcagttgcgggagaggaaggggaaggtt
ttgggtgcgggtgcgggtgcgtatgtggagagtgcgtatagtgatggggtggagagtgtg
aggagtgttagtcggggtagcagtagtcggaggcagacgatgcatgagctgccgttgacc
acgaacggcggggttaacgaagagcagcagccactggtgcgaagggtgagtagacggctc
agtggcgggagtgcgttgagtggcgtgtcggacggtttggtgagtattgacgccgatccg
ccgcccattcctgctgtacctgtccccactttcgcgccagcggcaatgacaaacggaaac
atgagaccaccagctgtccccgctctgacaggaaatggtggcgcaatgcaagtcaagaaa
acgcgggcgccgcccgctgcagcgaagccgaagaagccagccgggcaagcacagcacgta
cctgtgccgacgagcgccccggagccgtccccggccgcaaatggcggcactgtggttaat
gacttacacgagctgacatccggcctgaagcgtatctcgctcaaagtcggctcgcgcgag
gagcatgaccggaagctgaaggagaaggagcgagatgtggcggctgctgcggctgcggag
cgcagtgcgagggccaaaagggcggcggagacgaggagggtgaatgcggcggctaggaag
gctgcg

DBGET integrated database retrieval system