KEGG   Baudoinia panamericana: BAUCODRAFT_78276Help
Entry
BAUCODRAFT_78276  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00020  Citrate cycle (TCA cycle)
bcom00480  Glutathione metabolism
bcom01100  Metabolic pathways
bcom01110  Biosynthesis of secondary metabolites
bcom01130  Biosynthesis of antibiotics
bcom01200  Carbon metabolism
bcom01210  2-Oxocarboxylic acid metabolism
bcom01230  Biosynthesis of amino acids
bcom04146  Peroxisome
Module
bcom_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcom_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAUCODRAFT_78276
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAUCODRAFT_78276
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    BAUCODRAFT_78276
Enzymes [BR:bcom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BAUCODRAFT_78276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 19117160
NCBI-ProteinID: XP_007680504
JGI: Bauco1_78276
UniProt: M2N1P3
LinkDB All DBs
Position
Unknown
AA seq 414 aa AA seqDB search
MATSIPKIKVKNPVVELDGDEMTRIIWQDIKDKFIHPYLDIDLKYYDLGLPYRDETNDQV
TIDAAEAIKKYSVGVKCATITPDEARVEEFKLKQMWLSPNGTLRNALGGTVFREPIVIPK
IPRLVPGWKKPIVIGRHAFGDQYRAKDRVIDGPGTLEMVFTPKGGQPERIKVFEFDEHHQ
GGVAQTQYNTAESITGFAHASFKHALSLKYPMYMTTKNTILKKYDGRFKDIFQDIYEKEY
RKDFEAAGIWYEHRLIDDMVAQMIKSEGGMVIAMKNYDGDVQSDIVAQGFGSLGLMTSVL
ITPDGKTFEAEAAHGTVTRHFREHQKGNPTSTNPIASIFAWTRGLAKRGELDGTPEVVKF
AESLEEACIHVVDQQGIMTKDLAISCGKKDDYVTTTEYLDAVEKRMKAVLSAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggccacctcaatccctaagatcaaggtcaagaatcccgtcgttgagctggacggcgat
gagatgactcgtattatatggcaagacatcaaggacaagttcattcacccgtaccttgac
atcgacctgaaatactacgacctgggcctgccgtaccgagacgagaccaacgaccaggtg
acgattgatgctgcggaagccattaagaagtacagcgtcggggtcaaatgtgccaccatc
acaccagacgaggcgagagtggaggagttcaagctgaagcagatgtggttgagtccgaac
ggcaccctcagaaacgcgcttggcggcacggtgttccgagaacccattgtcattcccaag
atcccacgtctggtgccaggctggaagaagccgatagtcattggcagacatgcattcggc
gaccagtatcgggcgaaggacagagtgattgacgggcctggcacgctggagatggtcttc
acgcctaagggtggccagccggagagaatcaaggtctttgagttcgatgagcatcatcaa
ggtggtgtcgcacagacgcaatacaacaccgcagaaagcatcactggcttcgcccacgca
tctttcaagcacgcattgagtttgaagtatcccatgtacatgaccaccaagaacaccatc
ctgaagaaatatgacggcaggttcaaggatatcttccaggatatctatgagaaggagtac
cggaaagactttgaggcggcgggtatctggtacgagcatcgactcatcgacgacatggtc
gcgcagatgatcaaaagcgaaggcggcatggtgattgcgatgaagaactacgacggcgac
gttcagtccgacattgtagcccagggctttggctcacttggtctcatgacctccgttctc
atcaccccagacggcaagaccttcgaagccgaagcggctcacggcaccgtcacgcgacat
ttccgcgagcaccagaaaggcaatcctacctccacgaatcccatcgcatccatcttcgcc
tggacaagaggtcttgccaagcgtggcgagctcgatggcacgccagaggttgtgaagttt
gcggagagtcttgaggaggcgtgtatccatgtcgtagaccagcagggcattatgaccaag
gatcttgcaatcagctgtggtaagaaggacgactacgtgactacgacggagtatctcgat
gcggtggaaaagcggatgaaggcagtcctgagcgcgaaattatag

DBGET integrated database retrieval system