KEGG   Baudoinia panamericana: BAUCODRAFT_90175Help
Entry
BAUCODRAFT_90175  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
Organism
bcom  Baudoinia panamericana
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 TrkA_N Pyr_redox NAD_binding_7 PALP Pyr_redox_2 NTP_transf_3 Shikimate_DH AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 19117461
NCBI-ProteinID: XP_007676346
JGI: Bauco1_90175
UniProt: M2ND59
LinkDB All DBs
Position
Unknown
AA seq 358 aa AA seqDB search
MKAVRFHGKEDLRVEDIPEPKCGKGQIKVKPAWCGICGSDLHEYLGGPSICPTDPHPITG
ELEVPVTFGHEFSGVIEEVGDGVSSKFKKGDRVCVQPIIYDGDCGACQDGLINCCYQNGF
VGLSGWGGGLSEHIVVPEYAVFHIPDNVGLDVAALVEPLAVAWHAVNASPFKPTDSVLVL
GGGPIGLSVIQALRARNCKQIIVSEVSSMRKQYAKDFGAHVVLDPTKDDIVARCRELADG
QGVHVTFDAAGVQSGLDQAILALRARGTHVNIAIWEKRCNFFPNDLVFREKSYLGVATYV
AGDFQEVINAISDGRLDMCKKMITKRVGLDEVVEEGFKALVRDKDNQVKILVRSSGEI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtgcgcttccatggcaaggaggacctgcgggtagaagacatcccggaaccg
aagtgcggtaagggacagattaaggtgaagcctgcttggtgtggcatctgcggtagtgat
ttgcacgaatacctaggtggaccgtcaatatgtccaaccgatcctcatccgatcaccgga
gaattagaagtcccggtgaccttcggccacgagttctctggagtaatcgaggaagtcggc
gatggagtctcaagcaagttcaagaagggcgatcgagtgtgcgtgcaacccatcatctac
gacggcgactgtggcgcttgccaggacgggttgatcaactgctgctaccaaaacggcttc
gtgggtttgagcggctggggtggcggcttgagtgagcacattgtggttcctgagtatgcg
gtgttccacataccagataacgttggccttgatgtcgcagccctggtcgagccactcgca
gtagcctggcatgccgtgaatgcctctcccttcaaaccaacagattccgtcctggtgctc
ggtggcggtccgatcggcctctcagtcatccaagctctccgagcccgcaactgcaagcaa
atcatcgtctccgaggtctcctcaatgcgaaagcagtacgccaaagacttcggcgcccat
gttgtgctcgacccaacgaaagatgacatcgtggcaagatgccgtgagctcgcggacggc
caaggcgtacacgtaaccttcgatgccgccggcgtgcagtctggccttgaccaggcgatc
ctggctctgcgagcgaggggcacgcatgtcaatattgccatatgggagaagagatgcaac
ttcttcccgaatgatttggtgttcagggagaaaagctatctcggtgtagcgacgtacgtg
gctggtgatttccaagaagtgatcaatgctatctccgatgggagattggacatgtgcaag
aagatgatcacgaagagggttggacttgatgaggttgtggaagagggattcaaggcgctg
gtcagggataaggacaatcaggtcaagattttggtgcgaagctccggcgaaatctga

DBGET integrated database retrieval system